KEGG   Mycobacterium indicus pranii: MIP_06149Help
Entry
MIP_06149         CDS       T02325                                 

Definition
F420-0:gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mid  Mycobacterium indicus pranii
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:mid00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4459946..4461298
Genome map
AA seq 450 aa AA seqDB search
MTPSPGEHGTAAAIEILPVAGLPEFRPGDDLGAAVAAAAPWLRDGDVVVVTSKAVSKCEG
RLVPAPRDPEERDRLRRKLVDDEAVRVLARKGKTLITESRIGLVQAAAGVDGSNVGRDEL
ALLPVDPDGSAATLRAALRERLGVEVAVVITDTMGRAWRNGQTDAAVGAAGLAVLHGYSG
ALDQHGNELLVTEVAIADEIAAAADLVKGKLTAMPVAVVRGLSVTDDGSTARDLLRPGTE
DLFWLGTAEAIDMGRREAQLLRRSVRRFSAEPVPADLVEAAVAEALTAPAPHHTRPVRFV
WLQHPGTRARLLDRMKDKWRSDLAGDGRPAEAIERRVARGQILYDAPEVVIPILVPDGAH
SYPDAARTDAEHTMFTVAVGAAVQALLVALAVRGLGSCWIGSTIFAADLVRAELDLPADW
EPLGAIAIGYAAEPAGPRDAADPGDLLIRK
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
ttgaccccctcccccggcgagcacggcaccgccgccgcgatcgagatcctgcccgtcgcc
gggctgcccgaattccggccgggcgacgatctgggcgcggccgtcgccgcggccgcgccg
tggctgcgcgacggcgacgtcgtggtggtcaccagcaaggcggtgtccaaatgcgagggc
cggctggtgccggcgccccgcgacccggaggagcgcgatcggctgcggcgcaagctggtc
gacgacgaggccgttcgggtgctggcccgcaagggcaagaccttgatcaccgagagccgg
atcgggctggtgcaggccgccgcgggcgtggacggctccaacgtcgggcgcgacgagttg
gccctgctgcccgtcgacccggacggcagcgccgccacgctgcgcgccgcgctgcgcgag
cggctcggcgtcgaggtcgccgtcgtcatcaccgacaccatgggccgcgcctggcgcaac
ggccagaccgacgcggcggtgggcgccgcgggactggctgtgctgcacggctattcgggg
gcgctcgaccagcacggcaacgagttgctggtcaccgaggtcgcgatcgccgacgagatc
gccgcggccgccgacctggtcaagggcaaactgaccgcgatgccggtggcggtggtgcgc
ggcctgtccgtgaccgacgacggctcgacggcacgggacttgttgcggcccggcaccgaa
gacctgttctggctcggcacggccgaggcgatcgacatgggccgccgcgaggcgcagctg
ctgcgccgatcggtgcgccggttcagcgccgagccggtcccggccgatctggtggaggcg
gccgtcgccgaggccctcaccgcgccggccccccaccacacccgcccggtgcggttcgtc
tggctgcagcacccgggcacccgggcccggctgctggaccgcatgaaggacaagtggcgc
agcgacctcgccggcgacggcaggcccgccgaggccatcgagcgccgggtggcgcgcggc
cagatcctctacgacgcgcccgaagtcgtcatcccgatcctggttcccgacggcgcccac
tcctatccggacgccgcccgcaccgacgccgagcacaccatgttcaccgtggccgtcggg
gcggccgtgcaggccctgctggtcgcgctggcggtgcgcgggctgggcagctgctggatc
gggtcgacgatcttcgccgccgacctggtgcgcgccgagctcgacctgcccgccgactgg
gagccgttgggcgccatcgccatcggctacgccgccgagcccgccggcccgcgcgacgcc
gcggatcccggggacctgctgatccgcaagtga

DBGET integrated database retrieval system