KEGG   Mycobacterium indicus pranii: MIP_06271Help
Entry
MIP_06271         CDS       T02325                                 

Definition
cytidine deaminase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mid  Mycobacterium indicus pranii
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MIP_06271
Enzymes [BR:mid01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MIP_06271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4542671..4543954)
Genome map
AA seq 427 aa AA seqDB search
MPPAFDAPTVIRTKRDGGRLSDAAIDWVVDAYTAGRVAEEQMAALLMAILLRGMDRGETA
RWTSAMLASGERLDFSDLGVPTVDKHSTGGVGDKITLPLVPVVAACGAAVPQASGRGLGH
TGGTLDKLESIAGFTAALSNRRVRDQLRDLGAAIFAAGDLAPADAKLYALRDITATVESL
PLIASSVMSKKLAEGAGALVLDVKVGSGAFTDSEAQSRDLASAMVALGAAHGVPTRALLT
DMNTPLGATVGNALEVAESLEVLAGGGPPDVVELTLRLASEMLELAGVDGRDPAETLRDG
TAMDRFRQLVAAQGGDLSVPLPIARHAETVTATRGGTMGDIDAMAVGLAAWRLGAGRSRP
GDRVQFGAGIRLHRRPGEPVTAGEPLFTLYTDTPGRFGAALAELDGAFGVGDAAPASRPL
IIDRIAQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgccttcgacgcgcccacggtgatcaggaccaagcgcgacggcggccggttg
tccgacgccgccatcgactgggtcgtcgacgcctacaccgccggccgggtggccgaggag
cagatggcggccctgctgatggcgatcctgttgcggggcatggatcgcggcgagacggcc
cggtggacgtcggcgatgctggcctcgggcgagcggctcgacttcagcgacctcggcgtg
cccacggtcgacaagcactccaccggcggggtgggggacaagatcaccctgcccctggtg
cccgtcgtcgccgcgtgcggcgccgcggtgccgcaggcgtcgggccgcgggctcggccac
accggcggcacgctggacaagctggaatccatcgccggattcaccgccgcgctgtccaac
cggcgggtgcgcgaccaactgcgcgacctcggcgcggccatcttcgccgccggtgacctg
gccccggccgacgccaagctgtacgcgctgcgcgacatcaccgccaccgtcgagtcgctg
ccgctgatcgcgagctcggtgatgagcaagaagctggccgagggggccggcgcgctggtg
ctcgacgtgaaggtcggttccggggcgttcaccgactcggaagcgcagtcccgcgacctg
gcgagcgccatggtcgcgctgggcgccgcgcacggggtgcccacccgcgcgctgctgacg
gacatgaacaccccgctgggcgcgaccgtcggcaacgccctcgaggtcgccgagtcgctc
gaggtgctggccgggggcgggccgcccgacgtcgtcgagctgacgctgcggctggcctcc
gagatgctcgagctggccggggtcgacggccgcgatcccgccgagacactgcgggatggc
accgcgatggaccggtttcgccagctcgtcgccgcccagggcggcgatttgtcggtgccg
ctgccgatcgctcggcatgccgagaccgtgaccgccacccggggcggcacaatgggcgat
atcgacgcgatggcagtggggctggcggcttggcggctcggagcgggcagatcccgtccg
ggcgatcgcgtgcagttcggcgccggcatccggctgcatcgccgccccggcgagccggtc
acggccggtgagccgctgttcaccctgtacaccgacaccccggggcgcttcggcgcggcg
ctcgccgagctggacggcgccttcggcgtcggcgacgccgccccagcttcgcgtccgctg
atcatcgatcggatcgcgcaatga

DBGET integrated database retrieval system