KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_06273Help
Entry
MIP_06273         CDS       T02325                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein SdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00020  Citrate cycle (TCA cycle)
mid00190  Oxidative phosphorylation
mid00650  Butanoate metabolism
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01120  Microbial metabolism in diverse environments
mid01130  Biosynthesis of antibiotics
mid01200  Carbon metabolism
Module
mid_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mid_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mid_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MIP_06273
   00650 Butanoate metabolism
    MIP_06273
  Energy metabolism
   00190 Oxidative phosphorylation
    MIP_06273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF5345
Motif
Other DBs
NCBI-ProteinID: AFS16222
UniProt: J9WNF9
Position
4544963..4545433
Genome map
AA seq 156 aa AA seqDB search
MSSPDLQLTRGQTAPVKQRSYDRPASLDNPRSPRRRAGIPNFEKFAWLFMRFSGIALFVL
AIGHLFIMLMWDNGVYRIDFNYVAQRWASPFWQFWDLALLWLAQLHGGNGLRTIIDDYSR
KDSTRFWLNSLLLLSMGFTLVLGTYVLLTFDPNIHA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccccgaccttcagctgacccgcggccagacggcgccggtcaaacaacgcagc
tacgaccggcccgccagcctggacaatccccgctcgccgcggcgccgggccggcatcccc
aacttcgagaagttcgcctggctgttcatgcggttctcgggcatcgcgctgttcgtgctg
gcgatcggccacctgttcatcatgctgatgtgggacaacggcgtgtaccgcatcgacttc
aactatgtggcgcagcgctgggcgtcgccgttctggcaattctgggacctcgcgctgctg
tggcttgcgcagctgcacggcggcaacggcctgcgcacgatcatcgacgactacagccgc
aaggacagcacccggttctggctcaacagcctgctgttgctgtcgatggggttcacgttg
gtgctgggcacctacgtgctgctgacgttcgaccccaacattcacgcctga

DBGET integrated database retrieval system