KEGG   Mycobacterium indicus pranii: MIP_06364Help
Entry
MIP_06364         CDS       T02325                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
mid  Mycobacterium indicus pranii
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:mid00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4608861..4610597)
Genome map
AA seq 578 aa AA seqDB search
MKPDYDVLIIGSGFGGSVSALRLTEKGYRVGVLEAGRRFADEDFAETSWDLRKFLWAPKL
GCYGIQRIHPLRNVLILAGAGVGGGSLNYANTLYVPPEPFFKDQQWSHITDWRDELMPHY
DQARRMLGVVENPTFTDADRVVKEVADDMGCGDTFVPTPVGVFFGPDGTKAPGKTVPDPY
FGGAGPERTGCLECGCCMTGCRYGAKNTLLKNYLYLAESGGAQVIPMTTVKRFEQRPDGL
WEVRTVRTGSWLRRDRRTYTAKHLILAAGTWGTQHLLFKMRDEGRLPRLSNRLGVLTRTN
SESIVGAGRLEVSPDLDLTHGVAITSSIHPTPDTHIEPVRYGKGSNAMGLLQTLMTDGPG
PEGTDVPRWKQLLDTAREDPRGMLRLLNPRQWSERTMIALVMQHLDNSITTFTKRGKLGI
RWYTSKQGHGEPNPTWIPVGNEVTRRIAAKIDGVAGGTWGELLNIPLTAHFLGGAVIGDN
ADHGVIDPYHRVYGYPTLYVVDGAAISANLGVNPSLSITAQAERAASLWPNNGENDRRPA
QGEPYRRLDPIAPAHPRVPLSAPGALRWSPVDPVSSVG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggattacgacgtactgatcatcggttcgggttttgggggcagcgtcagcgca
ttgcggctgacggaaaagggctaccgcgtcggcgtcctcgaggccggacgccggttcgcc
gacgaggatttcgcggagacgtcctgggatctgcgcaagttcctgtgggcgccgaagctg
ggttgctacggcatccagcgcatccacccgctacgcaacgtgctgatcctggccggcgcc
ggcgtgggcggcggctcgctgaactacgccaacacgctgtatgtgccgccggagccgttc
ttcaaagaccagcagtggtcgcacatcaccgactggcgcgacgagctgatgccgcactac
gaccaggcgcgacgcatgctgggcgtggtggaaaacccgaccttcaccgacgccgatcgc
gtcgtcaaggaggtcgccgacgacatgggctgcggcgacacgttcgtgccgacgccggtc
ggggtgttcttcggccccgacggcaccaaggcgccgggcaagaccgtgccggacccctac
ttcggcggcgccggacccgagcgcaccggctgcctggagtgcggctgctgcatgaccggg
tgccgctacggcgccaagaacaccctgctgaagaactacctctatctcgcggaatcgggt
ggggcgcaagtcattccgatgacgaccgtgaagcggttcgagcagcgccccgacgggctg
tgggaggtccgcacggtgcgcaccggcagttggctgcgccgcgaccggcgcacctacacc
gccaagcacctgatcctggccgccgggacgtggggcacccagcacctgctgttcaagatg
cgcgacgagggccggctgccccggctctccaaccgcctcggcgtgctgacccgcaccaac
tccgagtccatcgtcggggccgggcgcctggaggtctctccggatctggacctcacccac
ggggtggcgatcacgtcgtcgatccacccgacgcccgacacccacatcgagccggtccgc
tacggcaagggctccaacgcgatggggctgctgcagacgttgatgaccgacgggccgggc
cccgaaggcaccgacgtgccacgctggaagcagttgctggacaccgcccgtgaagatccg
cgcggaatgctgcggctgctcaacccgcgccagtggagtgagcgcaccatgatcgcgctg
gtgatgcagcacctggacaactcgatcaccacgttcaccaaacgcggcaagctcggcatc
cgctggtacaccagcaagcagggccacggcgagccgaacccgacgtggatcccggtgggc
aacgaggtcacccgccgcatcgccgccaagatcgacggcgtggcgggcggcacctggggc
gagctgctcaacatcccgctgaccgcgcacttcctcggcggcgcggtgatcggcgacaac
gccgaccacggggtcatcgacccctatcaccgggtctacggctacccgacgctgtatgtg
gtggacggcgcggcgatctcggcgaacctgggcgtgaatccgtcgctgtccatcaccgcc
caggccgagcgggccgcgtcgctgtggccgaacaacggcgaaaacgaccggcgcccggcg
cagggcgagccgtatcgccggctggatccgatagcgccggcgcacccgcgggtgcccctc
tccgccccgggcgcgctgcgctggtcaccggtcgatccggtcagctcggtgggctag

DBGET integrated database retrieval system