KEGG   Mycobacterium indicus pranii: MIP_06684Help
Entry
MIP_06684         CDS       T02325                                 

Definition
N-acetylmannosamine kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mid  Mycobacterium indicus pranii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MIP_06684
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MIP_06684
   00052 Galactose metabolism
    MIP_06684
   00500 Starch and sucrose metabolism
    MIP_06684
   00520 Amino sugar and nucleotide sugar metabolism
    MIP_06684
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MIP_06684
   00524 Butirosin and neomycin biosynthesis
    MIP_06684
Enzymes [BR:mid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MIP_06684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4818386..4819306)
Genome map
AA seq 306 aa AA seqDB search
MPTLCLDIGGTKIAAALVDSAGALVHSAIRPTPVTTAAGDVWAVVEAMIADAVRAADVPI
TAVGIASAGPIDLHTGSVSPINIAGWDRFPLRDRVAAAVPGVPVVLGGDGLCMALGEHWI
GAGRSAGPDARFLLGMVVSTGVGGGLVLDGVPYAGRTGNAGHVGHIVVELDGPPCTCGGR
GCVETVASGPWMVRWARDNGWAAPPGAGARDLAVAAAAGDPVARRAFHRSANALAAMIAS
VGAVCDLDLVVIGGGVSKSGPLLFDPLRAKLADYAGLDFLSGLRVVPGELGGAAGLIGAA
RLAALG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccctctgcctggacatcggcggcaccaaaatcgccgccgcactggtcgattcg
gccggcgcgctggtgcacagcgcgatccgccccaccccggtcacgaccgccgccggcgac
gtgtgggccgtcgtcgaggcgatgatcgccgacgcggtgcgcgcggccgacgtcccgatc
accgccgtcggcatcgcctcggccgggccgatcgacctgcacaccggatcggtcagcccg
atcaacatcgcgggctgggaccgtttcccgctgcgcgacagggtcgccgccgcggtgccc
ggggtgccggtggtgctgggcggcgacggcctgtgtatggcgttgggcgagcactggatc
ggggcgggccgcagcgcggggccggacgcccggttcctgctgggcatggtggtctccacc
ggggtgggcggcggtctggtgctcgacggcgtcccctacgccgggcgcaccggcaacgcc
ggccacgtcgggcacatcgtcgtcgaactggacgggccgccgtgcacgtgcggcggccgc
ggctgcgtggagacggtggcgtccgggccgtggatggtgcgctgggcgcgcgacaacggg
tgggcggcgccgcccggcgcgggcgccagggacctggccgtcgcggcggcggccggagac
ccggtggcccgccgggcctttcaccgatcggcgaacgcgctcgccgcgatgatcgcctcg
gtcggcgcggtctgcgatctggacctcgtcgtgatcgggggaggggtgtccaaatccggg
ccgctgctcttcgaccccctgcgggcgaagctggccgactacgcggggctggacttcctg
tccgggctgcgggtggtgcccggcgagctcggcggtgcggccggcctgatcggcgcggcc
cgcctcgcggccctgggctga

DBGET integrated database retrieval system