KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_06684Help
Entry
MIP_06684         CDS       T02325                                 

Definition
(GenBank) N-acetylmannosamine kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00010  Glycolysis / Gluconeogenesis
mid00052  Galactose metabolism
mid00500  Starch and sucrose metabolism
mid00520  Amino sugar and nucleotide sugar metabolism
mid00521  Streptomycin biosynthesis
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01120  Microbial metabolism in diverse environments
mid01130  Biosynthesis of antibiotics
mid01200  Carbon metabolism
Module
mid_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MIP_06684
   00052 Galactose metabolism
    MIP_06684
   00500 Starch and sucrose metabolism
    MIP_06684
   00520 Amino sugar and nucleotide sugar metabolism
    MIP_06684
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MIP_06684
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MIP_06684
Enzymes [BR:mid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MIP_06684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AFS16501
UniProt: J9WMD5
Position
complement(4818386..4819306)
Genome map
AA seq 306 aa AA seqDB search
MPTLCLDIGGTKIAAALVDSAGALVHSAIRPTPVTTAAGDVWAVVEAMIADAVRAADVPI
TAVGIASAGPIDLHTGSVSPINIAGWDRFPLRDRVAAAVPGVPVVLGGDGLCMALGEHWI
GAGRSAGPDARFLLGMVVSTGVGGGLVLDGVPYAGRTGNAGHVGHIVVELDGPPCTCGGR
GCVETVASGPWMVRWARDNGWAAPPGAGARDLAVAAAAGDPVARRAFHRSANALAAMIAS
VGAVCDLDLVVIGGGVSKSGPLLFDPLRAKLADYAGLDFLSGLRVVPGELGGAAGLIGAA
RLAALG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgccaaccctctgcctggacatcggcggcaccaaaatcgccgccgcactggtcgattcg
gccggcgcgctggtgcacagcgcgatccgccccaccccggtcacgaccgccgccggcgac
gtgtgggccgtcgtcgaggcgatgatcgccgacgcggtgcgcgcggccgacgtcccgatc
accgccgtcggcatcgcctcggccgggccgatcgacctgcacaccggatcggtcagcccg
atcaacatcgcgggctgggaccgtttcccgctgcgcgacagggtcgccgccgcggtgccc
ggggtgccggtggtgctgggcggcgacggcctgtgtatggcgttgggcgagcactggatc
ggggcgggccgcagcgcggggccggacgcccggttcctgctgggcatggtggtctccacc
ggggtgggcggcggtctggtgctcgacggcgtcccctacgccgggcgcaccggcaacgcc
ggccacgtcgggcacatcgtcgtcgaactggacgggccgccgtgcacgtgcggcggccgc
ggctgcgtggagacggtggcgtccgggccgtggatggtgcgctgggcgcgcgacaacggg
tgggcggcgccgcccggcgcgggcgccagggacctggccgtcgcggcggcggccggagac
ccggtggcccgccgggcctttcaccgatcggcgaacgcgctcgccgcgatgatcgcctcg
gtcggcgcggtctgcgatctggacctcgtcgtgatcgggggaggggtgtccaaatccggg
ccgctgctcttcgaccccctgcgggcgaagctggccgactacgcggggctggacttcctg
tccgggctgcgggtggtgcccggcgagctcggcggtgcggccggcctgatcggcgcggcc
cgcctcgcggccctgggctga

DBGET integrated database retrieval system