KEGG   Mycobacterium indicus pranii: MIP_07273Help
Entry
MIP_07273         CDS       T02325                                 

Definition
Uroporphyrinogen-III synthetase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mid  Mycobacterium indicus pranii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MIP_07273
Enzymes [BR:mid01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MIP_07273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5219903..5221066
Genome map
AA seq 387 aa AA seqDB search
MAPQLAPPDSAPLTGYRIAVTSANRAEELCALLRRNGAEVSSAAAIDLIALPEDEELQRH
TEAVIAEPPDILVAHTGIGFRGWVAAADGWGLATQLLASLSRARIVARGPKATGALRAAG
LHEEWSPRSESSSEVLRYLLESDVAGKRVAVQLHGAADTWDPFPEFLNGLRSAGAQVVPI
HVYRWKPTPAGGEFDQLVTSVARRQFDAVTFTSAPAGAALLERSRELGVEEQLLQALRSD
VHAMCVGPVTAQPLLRAGVPTSSPERMRLGALARHIAQELPTLRSTTIRAAGHEMEIRGT
CVLVDGSPRSLSGSGMATLRALAERPGDVVARNDLLRVLPGNSNDPHAVDTAVLRLRTAL
GDKNIIATVVKRGYRLAIDHPDESPWH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggccccccaactggccccaccagactccgcgccgctgaccggctaccggatcgccgtg
acgtcggcgaaccgggccgaagagctgtgcgcgttgctgcgccgcaacggcgcggaggtg
tccagcgccgcggccatcgacctcatcgcgctgcccgaagacgaagaactgcagcgccac
accgaagcggtcatcgccgagcctcccgatatcttggtggcgcacaccggcatcggcttc
cgcggctgggtcgccgcggccgacggctggggactggccacccagctgctggcgtccctg
tcccgggcgcggatcgtggcccgcgggccgaaggcgaccggcgccttgcgcgccgccgga
ctgcacgaggagtggtcgcccaggtccgaatcgtcgagcgaggtcctgcgctacctgctc
gaatcggatgtcgccggtaagcgggtcgcggtccagctgcacggcgcggccgacacctgg
gatccgttcccggaattcctcaacgggttgcggtccgcgggcgcccaggtggtccccatc
cacgtatatcgctggaaaccaacgccggccggcggcgagttcgaccaactcgtcacctcg
gtcgcccggcggcagttcgacgcggtgaccttcacctcggcgcccgcgggcgcggcgctg
ctggagcgcagccgcgagttgggcgtcgaagagcaactgctgcaagcgcttcgcagcgac
gtgcacgcgatgtgcgtgggcccggtcaccgcgcagcccctgctccgcgccggggtcccc
acgtcgtcgcccgagcgaatgcggttgggggcgttggcccgtcacatcgcccaggagctc
ccgacccttcgctcgaccaccatccgggccgccggccacgagatggagatccgcgggacc
tgcgtgctggtcgacggttcgccgcggtccctgtcgggatcgggaatggcgacgctgcgc
gcgctggcggagcgccccggcgacgtcgtcgcgcgcaacgacctgttgcgggtgcttccc
ggcaacagcaacgatccccacgccgtcgacacggccgtgctgcggctgcgaacggcgctg
ggcgacaagaacatcatcgcgacggtggtcaagcgtggctaccggctcgcgatcgaccat
ccggacgaatccccatggcactga

DBGET integrated database retrieval system