KEGG   Mycobacterium indicus pranii: MIP_07308Help
Entry
MIP_07308         CDS       T02325                                 

Definition
glycosyl hydrolase family protein 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mid  Mycobacterium indicus pranii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MIP_07308
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MIP_07308
Enzymes [BR:mid01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MIP_07308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5242496..5243647)
Genome map
AA seq 383 aa AA seqDB search
MAFSRTFAVLAAASALVAGCGHHPAPPAHSSTSSKPAAAPAPPVCADPAAVPAALGIRDK
LAQLLMVGVKNADDARAVVNGYHVGGIFIGSWTDLTIFQGPLADISAKAGPLPLAVSVDE
EGGRVSRLKTLIGTSPPARELAQTQTVQQVHDLAADRGHKMRDLGITVDFAPVVDVSDED
DDAVIGNRSFGADPQTVTDYAGAYAQGLRDAGLLPVLKHFPGHGHGSGDSHTGGVVTPPL
ADLQTSDLVPYRSLVAAAPVAVMVGHLQVPGLTGDVPASLSPEAVQLLRNGVGYKGPPFT
GPVFSDDLSSMAAISDRYGVSEAVLRSLLAGVDVALWVTTDEVPAVLDRLQKAVASGELP
TRRVDEALVRVAKMKGPGPTCGH
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcattttcgcgcaccttcgccgtgcttgcggccgcgtcggcgctggtggccggctgc
ggccaccaccccgcgccacccgcccactcgtcgacgtcgagtaagccggcggccgcgccc
gcgcccccggtgtgcgccgacccggcggcggtgccggccgcgctgggcatccgcgacaag
ctggcccaactcctgatggtgggcgtgaagaacgccgatgacgcccgggccgtcgtcaac
ggctaccacgtcggcgggatcttcatcggcagctggaccgacctgacgatcttccagggg
ccgttggcggacatcagcgccaaggcgggaccgctgccgctggcggtcagcgtcgacgaa
gagggtggccgggtgtcgcggctgaagaccctgatcggcacgtcgccgccggcccgggag
ctggcgcagacacaaaccgtccagcaggtccacgatttggccgccgaccgcggccacaag
atgcgcgacctgggcatcaccgtcgacttcgctcccgtggtcgacgtcagcgacgaggac
gacgacgccgtcatcggcaaccgttccttcggcgcggacccgcagacggtgaccgactac
gccggggcgtacgcgcagggcctccgcgacgccgggctgctgccggtgctcaagcatttc
cccgggcacgggcacggctcgggtgattcgcacaccggcggggtagtcacgccgccgctc
gccgacctgcagaccagtgacctggtgccctaccggtcgctggtggccgcggcgccggtc
gcggtgatggtgggccacctgcaggtcccgggcctcaccggcgatgtccccgccagcctg
agccccgaggcggtgcaattgttgcgcaacggcgtcggctacaagggtccgccgttcacc
ggcccggtgttcagcgacgacctgtccagcatggccgccatctccgaccggtacggggtg
tcggaggcggtgctgcgcagcctgttggccggcgtcgacgtcgcgctgtgggtcaccacc
gacgaggtgcccgcggtgctggaccgcttgcaaaaggccgtcgcctcaggcgaactgccg
acacgacgggtggatgaggcgctggtgcgggtggcgaagatgaagggccccggcccgacc
tgcgggcactag

DBGET integrated database retrieval system