KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_07545Help
Entry
MIP_07545         CDS       T02325                                 

Definition
(GenBank) Putative dihydroflavonol-4-reductase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Brite
Enzymes [BR:mid01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     MIP_07545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase NAD_binding_10 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 NmrA Polysacc_synt_2 RmlD_sub_bind TrkA_N KR
Motif
Other DBs
NCBI-ProteinID: AFS17066
UniProt: J9WNS9
Position
complement(5406399..5407418)
Genome map
AA seq 339 aa AA seqDB search
MTARPKLVIGANGFLGSHVTRQLVAKGHEVRAMVRENANTRSIDDLELTRFHGDVFDTAV
LREAMDGVDDVYYCVVDTRAWLRDTSPLFRTNVEGLRNVLDVAVAQPDLRRFVFTSTYAT
VGRRRGRVATEDDIVATRGLSDYVQSRVQAENLVMRYVAESGLPAVAMCVSTTYGSGDWG
RTPHGAFIAGAVFGKLPFTMDGIQLEVVGVTDAAEAMLLAAERGRVGERYLISERMIALT
EVVRIAADEAGVPPPRRSIPVPVLYALGALGSLRARLTGKDAELSLASVRMMRAEAPVDH
SKAVRELGWQPRPVEESIREAARFWAAMRNAKGKSATPR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccaggcccaaactcgtcatcggcgccaacggcttcctgggttcgcacgtcacg
cgccagctggtcgccaagggccatgaagtgcgggccatggtgcgcgagaacgccaacacc
cggtccatcgacgacctcgagctcacccggtttcacggtgacgtgttcgacaccgccgtg
ctgcgggaggccatggacggggtcgacgacgtctactactgcgtcgtcgacacccgcgcc
tggctgcgcgacacctcgccgctgtttcgcaccaacgtcgaggggctgcgcaacgtcctc
gacgtggccgtcgcgcaacccgacctgcgtcggttcgtcttcaccagcacctacgcgacg
gtcggccggcggcgcgggcgcgtggcgaccgaggacgacatcgtcgccacccgcgggttg
tcggactacgtccaatcccgggtccaggccgagaacctggtgatgcgctacgtggccgaa
tccgggctgcccgcggtggcgatgtgcgtgtcgacgacctacggcagcggcgactggggc
cgcaccccgcacggcgcgttcatcgccggcgccgtcttcggcaagttgcccttcaccatg
gacggcatccaattggaggtcgtcggcgtcaccgacgccgcggaggccatgctgttggcc
gccgagcgcggccgcgtcggcgagcgatacctgatctccgagcgaatgatcgcgttgacc
gaggtggtgcggatcgcggccgacgaggccggcgtgccgccgccgcgacgttccatcccc
gttccggtgctgtacgccctcggcgccctgggcagcctgcgagcccggctcaccggcaag
gacgccgagctcagcctcgcgtcggtgcgcatgatgcgtgccgaggcgcccgtcgaccac
agcaaggccgtccgcgaattgggttggcagccacgcccggtcgaggagtccatccgcgag
gcggcccgattctgggccgccatgcgaaatgccaagggtaagagcgcgactccccgctga

DBGET integrated database retrieval system