KEGG   Methanocaldococcus infernus: Metin_0038Help
Entry
Metin_0038        CDS       T01234                                 

Definition
nitrogenase alpha chain (EC:1.18.6.1)
Orthology
K02586  
nitrogenase molybdenum-iron protein alpha chain [EC:1.18.6.1]
Organism
mif  Methanocaldococcus infernus
Pathway
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Nitrogen fixation, nitrogen => ammonia
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:mif00910]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(33662..35095)
Genome map
AA seq 477 aa AA seqDB search
MPFVLLDCDKPIPERMKHTYIYDPEEEIIPACNIKTIPGDMTERGCSFAGARGVVGGPVK
DVIHMVHGPIGCAFYTWGTRRNLSDFELHRRYCFSTDMQEADIVYGGEKKLEKACIEAAE
EFPEAKGIFIYATCPTALIGDNLEAVARKVEEKIKKPVFACNSPGFAGCSQSKGHHIFNT
EFYRWLRKAREKYPEKCLKEEEKTPYDIAIVGEYNMDWDLKVIKPLFEKIGCRVVAVFTG
NASLDDLFKLPDVKLCVVHCQRSANYIAEMIRDGYNVPRVWVSLFGIEQTAEALRKTAEV
LGIDKEKVEQVIKEEVEAIKPQLEFYKSKLEGKRCLVYVGGPRTWHWIRMFKELGVDVVV
ACCTFAHEDDYEKLNRNLKKAGLKGTLVIDAPNELELEEAIHKYKPDFMLTGLKERYLFR
KYGVPTINSHSYEQGPYAGFRGFVNFARDIYKAVCHPIWDILKEGEKKFEEFKKKNN
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgtgttattagattgtgataagccaattcctgaaaggatgaaacatacttac
atctatgatcctgaagaggagataattccagcatgtaatataaagacaatccctggggat
atgacagaaagaggctgttcctttgcaggagcaaggggggttgtaggagggccagtaaaa
gatgtcatccatatggttcatggtcctattggttgtgccttttacacttggggaacaagg
agaaatttgtcagattttgagcttcataggagatattgtttttcaacagatatgcaagag
gctgatatagtttatggaggagagaagaaattagagaaggcttgtatagaagctgctgaa
gaatttccagaggctaagggaattttcatctatgccacctgtccaacagccttaatagga
gacaacttagaggcagtggcaagaaaggttgaggaaaagataaaaaagcctgtctttgcc
tgtaactctccagggtttgctggctgttctcaatcaaaggggcatcatatatttaacaca
gaattttacagatggttaaggaaggcaagggaaaaatatcctgaaaagtgcttaaaggaa
gaggaaaagactccttatgatattgcaatagttggagaatataacatggactgggatttg
aaggttataaaaccattatttgaaaaaattggctgtagagttgtggctgtctttacagga
aatgcatcattagatgatctcttcaaattaccagatgtaaagctctgtgttgtccattgt
caaagatcagctaactatattgctgaaatgatcagagatggatacaatgtcccaagagtt
tgggtttctctatttggaatagagcaaacagctgaagctttaagaaagacagctgaggtt
ttgggaatagataaggagaaggttgagcaagtcattaaggaagaagttgaggcaattaag
ccacagttagaattttacaagtctaagttagagggtaaaagatgcttagtctatgttgga
ggaccaagaacttggcactggattagaatgtttaaagagcttggagttgatgttgtagta
gcctgctgtacctttgcccatgaagatgactatgagaagttaaatagaaatttaaagaaa
gctgggctaaagggaactttggttatagatgctcctaatgagcttgagttagaagaggct
attcacaagtataagccagacttcatgcttacaggattgaaggagagatatctatttaga
aagtatggagttccaactatcaactctcacagctatgaacaagggccatacgcaggattt
agaggatttgttaactttgcaagagatatttacaaagctgtctgtcatccaatttgggac
atcttaaaagagggagagaagaagtttgaagaatttaagaaaaagaataattaa

DBGET integrated database retrieval system