KEGG   Methanocaldococcus infernus: Metin_0063Help
Entry
Metin_0063        CDS       T01234                                 

Definition
Aldehyde ferredoxin oxidoreductase
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
mif  Methanocaldococcus infernus
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metin_0063
   01230 Biosynthesis of amino acids
    Metin_0063
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metin_0063
Enzymes [BR:mif01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     Metin_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
57335..59197
Genome map
AA seq 620 aa AA seqDB search
MVIKMKGVLINVKSKKFEVIEKNFLPIEWGFYWHEKFETYKLDPYHPNNVFTMSSGVLPI
VGGHRLVFTFKSPLWDGFYFSTLGGAGYQFKKTGLTHLAIVGKAEKPSLVVIDNGNIELF
EVKEEFSSVYELTDYIVENFKDKNLRSVVVGEASKKTSIGALFSQTIRNGERVEGSEDWA
ARGGGGSVLYRAHNILGIVFYGDKEEELEEEAKKIVENHYKEKFIKVVIEHTKKYRFDEK
TGTGGTFGNNWILYKEKVPIFNWRMPYISKEEREKILKVIFKNYLEVFNKEAIETKNWAN
CGEPCPVVCKKYRNKNKVDYEPYAANGTLLGIFDLYEVDKVMKKVDSLGFDAIEIGNLMA
WVFELLDVGLLKEEDLGIKKPIFNHKIVAEGDLEKIKEMSEHNSEQALTFIDNLIKQELE
IYKILALGKRKAGKVLNEKFKYRVKEKKFNDYAVYVAKGGWGEIGSNLYWTPGFFIPLPI
HGKYLTYYKPEFLEPEKLAELIVDSIKLEMTIENLGMCRFHRRWVKPVLKELGKKILGRE
DIERDSIELYRKIAEFNKKTGGPEKIESERVKDLIVGLAKEYDNKEWIEKFKDKEMVNEY
IKRVLDKYSELLNIDWRLRV
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
ttggtgataaaaatgaaaggagttttaataaatgttaaatctaaaaagtttgaggttata
gagaaaaatttcttgcccattgagtggggattctattggcatgagaagtttgaaacctat
aagttagatccttatcatcccaacaatgtctttaccatgagctctggagttttaccaatt
gttggaggacataggttagtctttacctttaaatctccactgtgggatggtttttacttc
tcaaccttgggaggagctggctatcaatttaaaaaaactggattaactcatttggcaatt
gttggaaaggctgaaaagccttctttagtggttatagataatgggaacatagagctcttt
gaggttaaggaagagtttagtagtgtttatgagctaactgactatatagtggaaaacttt
aaggataaaaatttaaggagtgtggtggttggagaagcttctaagaagacaagtatagga
gctctattttcacaaactataagaaatggggagagagttgaaggctctgaagactgggct
gcaagaggtggaggaggttcagttctctatagggctcacaatattttagggatagtattc
tatggagataaggaggaagagcttgaagaagaggctaagaagattgttgagaaccactat
aaagagaagtttataaaagtggttattgagcatacaaagaagtataggtttgatgagaaa
acaggaactggagggacatttgggaataattggattttatataaggagaaggttcctatt
ttcaattggaggatgccatatataagtaaagaggagagagaaaagatattaaaggttatc
tttaagaattatttagaggttttcaataaagaggcaattgaaacaaaaaattgggcaaac
tgtggagagccttgtccagtggtttgtaagaagtatagaaataaaaataaggttgactat
gagccctatgctgcaaatggaactttgttaggaatctttgacttatatgaagttgataaa
gttatgaaaaaagttgatagcttagggtttgatgctattgagattggtaatttaatggct
tgggtctttgagcttttagatgttggtctattaaaggaagaagacttaggaataaagaaa
ccaatctttaaccataaaattgttgctgaaggagacttagaaaaaataaaggagatgagt
gagcataatagtgagcaggcattaacatttatcgataatttaataaagcaagaacttgag
atttacaaaatcttagccttaggaaagaggaaggctgggaaggtattaaatgagaagttt
aaatatagagttaaggagaagaaatttaatgactatgctgtttatgtggcaaaaggtggt
tggggggagataggatcaaacctttactggactcctggcttttttattcctttgcctata
catgggaagtatttaacttactataagccagaattcttagagccagagaagttggctgag
ctaattgttgacagcataaagttggagatgacaattgaaaacttgggaatgtgtagattc
catagaagatgggttaagcctgtgttaaaagagcttggtaagaaaattttaggtagagaa
gatatagagagggactcaatagagctttatagaaagatagctgagttcaataaaaaaact
ggagggccagagaaaatagagagtgagagagttaaagatttaattgttggacttgctaag
gagtatgataataaagaatggatagagaagtttaaagataaggagatggttaatgagtat
ataaagagagttttagacaaatactcagaactattaaatattgattggagattaagggtt
taa

DBGET integrated database retrieval system