KEGG   Methanocaldococcus infernus: Metin_0092Help
Entry
Metin_0092        CDS       T01234                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mif  Methanocaldococcus infernus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metin_0092
  Amino acid metabolism
   00300 Lysine biosynthesis
    Metin_0092
Enzymes [BR:mif01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Metin_0092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(81452..82654)
Genome map
AA seq 400 aa AA seqDB search
MDVIELASDLIKIRSVNPYFGGEGEKEKGEYVKRKLIEIVKKHNFKDYELKEYNTIDKFG
ILRPNIVFKADFGREKTLHIIAHLDTVPEGDLSLWETNPYEPVIKDGKIYGRGAEDNHKA
IVSSLLLLDKLLEDKESKYNLSLIYVSDEEAGSKYGLKYLLNFEKEIFDKNDLIIVPDFS
SEDGSYIEIGEKGILWIKFIFEGKQCHGSVPEEGFNSNVVAFDFSNKLYKELYSKFNKVN
NIFLPEYSTFEPTIVKNKVTNPNTIPGKTEVVFDCRILPDYSIEEIISEIDNFIKGYNFK
PIHSSGEGRVRREILKLEKPNFTKEDSLVVRELKRAIKEVLNVEPKVCGMGGGTVAAFLR
ERGYDVAVWGIGEGTAHQPNEHIKIGSLEKMAEVFYKMLR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggatgttattgagttagcctctgatttgataaaaattaggtctgtaaatccctatttt
ggtggagaaggagagaaagaaaaaggagaatatgttaagagaaagttaatagagatagta
aaaaagcataactttaaagattatgagttaaaagaatacaatacaatagacaagtttgga
attttaaggccaaatattgttttcaaggcagactttgggagagagaagactttacatatc
atagctcacttagacacagttccagagggagatttaagcctttgggaaacaaacccttat
gagccagttataaaggatggtaagatctatggaagaggagcagaggataaccataaagct
atagtctcttctctcctactcttagataagctcttagaagataaagagagtaaatataat
ttatctttaatttatgtctctgatgaggaagctggtagtaagtatggcttaaagtatcta
ttaaattttgaaaaagagatttttgataaaaatgatctaatcatagttcctgacttcagc
tcagaggatgggagttatatagaaattggagaaaagggaattttatggataaaatttatc
tttgaaggaaagcagtgtcatggaagtgttcctgaggaggggtttaattcaaatgtagta
gcctttgacttctcaaacaagctatataaagagctatatagtaagtttaataaagtaaat
aatattttccttccagagtattctacatttgagcctacaattgttaagaataaagttaca
aatcctaacacaatcccagggaaaactgaggttgtctttgattgtaggatacttccagat
tatagtatagaagaaataataagtgagatagataactttataaaaggctataacttcaag
ccaatacactcaagtggtgaaggaagagttagaagagaaatattaaaattggagaaacct
aactttactaaggaggatagcttagtggttagagaactaaaaagagctataaaagaggtt
ttaaatgttgagcctaaggtttgtgggatgggtggaggaacagtagcagcttttttaagg
gaaagaggttatgatgtagctgtctggggcattggagagggaacagctcatcagccaaat
gagcatataaagatagggagcttggagaagatggctgaagttttctataaaatgttgagg
tga

DBGET integrated database retrieval system