KEGG   Methanocaldococcus infernus: Metin_0099Help
Entry
Metin_0099        CDS       T01234                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mif  Methanocaldococcus infernus
Pathway
mif00340  Histidine metabolism
mif01100  Metabolic pathways
mif01110  Biosynthesis of secondary metabolites
mif01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Metin_0099
Enzymes [BR:mif01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Metin_0099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh YtxH DUF4279 Cauli_AT RsmF_methylt_CI RRF
Motif
Other DBs
NCBI-ProteinID: ADG12771
JGI: Metin_0099
UniProt: D5VQB8
Position
complement(87468..88748)
Genome map
AA seq 426 aa AA seqDB search
MIFKSLYELTKEERERIINRNKANFDNIFDSVVKILRDVREKGDEALRYYTKLFDKVEIE
DFKVSREEIEEAYNKVDYKVVEALERAKENIYYFHKEQLKNIKELRVERNGVLGQIVRAI
EKVGCYVPGGRAFYPSTVLMTTIPAKVAGCKEIYITSPPTPEGKGNAATLIAGDLVKVNG
IYKVGGVQAIGALAYGTESIPKVDIIVGPGNIYVTLAKKLVYGEVNIDFLAGPSEVLIIG
DEFSNPNYIALDLLAQAEHDPNASCVALLTSREKAEEVKRELEKILKDIDERKEIIKEAL
KNLAILYGELEDLIKFSNEYAPEHLELFVREPEKILEKIESAGSIFLGEYSPVPIGDYAS
GTNHVLPTSGFSRCSSGLNVETFLKKITYQKFDKEALRNIKDVVITLAEAEGLKMHAEAV
RRRLRE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgatttttaaaagcttatatgagcttacaaaggaggaaagagaaagaataattaataga
aataaggcaaactttgataatatctttgactcagtggttaaaattcttagggatgtgaga
gagaagggagatgaggctttaagatattatactaaactctttgataaggttgagattgaa
gactttaaagtttcaagagaggagattgaagaagcttacaataaggtggattataaagtt
gtggaagctcttgaaagggctaaggagaatatatactatttccataaagagcaattgaag
aatataaaagagttgagagttgagagaaatggagttttagggcaaattgttagagctatt
gaaaaggttggctgttatgtgccaggaggaagagccttttatccttcaactgttctcatg
actaccatccctgctaaggttgctggctgtaaagagatctatataacttctcctccaact
cctgagggaaaggggaatgctgcaacactaatagctggagatttggttaaagttaatggc
atttataaagttggtggagttcaggcaattggagcattggcctatggaactgaaagtatt
ccaaaggttgatattattgtaggcccagggaatatttatgtcactctggctaagaagttg
gtttatggtgaagtaaatatagacttcttagctggtccatcggaggttttaattattggg
gatgagttctctaaccctaactatatagcccttgatctcttagctcaggctgaacatgat
ccaaatgcctcatgtgtagctcttttaacttcaagagagaaggcagaagaggttaagagg
gagttggagaagatattaaaagatatagatgagagaaaggagattattaaggaagcttta
aaaaacttggctatactttatggagagcttgaagatttaataaaatttagcaatgaatat
gctcctgaacaccttgagctctttgttagagagccagagaaaattttagagaaaatagag
agtgctggctccatctttttaggagagtattccccagtccctataggagactatgcctct
ggaaccaaccatgttttaccaacctcaggtttctcaagatgttcctctggcttaaatgtt
gaaacctttttaaagaaaattacatatcaaaagtttgataaggaagcattgagaaatata
aaagatgttgtaattaccttagctgaagctgaagggttaaagatgcatgcagaagctgtt
agaaggaggttgagagagtga

DBGET integrated database retrieval system