KEGG   Methanocaldococcus infernus: Metin_0133Help
Entry
Metin_0133        CDS       T01234                                 

Definition
Magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mif  Methanocaldococcus infernus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mif00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
121735..122772
Genome map
AA seq 345 aa AA seqDB search
MNNGDILTYPFTAIVGQEKMKKALILNAINPKIGGVLIRGEKGTAKSTAVRALADVLPEL
EVVEGCPFNCDPNGELCDICKERKKRGELKVIKRKMKVVNLPIGATEDRVVGTLDIEKAI
KEGIKALEPGILAEANRNILYIDEVNLLDDHIIDLLLDAAAMGWNIIEREGIRVKHPSRF
ILVGTMNPEEGELRPQILDRFGLMVEVEGLRDIKERVEVIKRVEEFNENPEAFYKRFEEE
QKKLKERIIKAREILKNVKIKDDLLELISKICLELGIQTSRADITVVRTAKAIAAFNGRE
YVTLDDIKEACELALPHRMRRKPFEPPRLEKERIEEIINNELKKN
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ataaataatggtgatatcttgacatatccatttacagcaattgttggacaggagaagatg
aaaaaagctttaattttaaatgcaataaatccaaaaattgggggagttctcattagaggg
gagaaggggacagctaaatctacagcagttagagccttggctgatgtacttccagagttg
gaagttgttgaaggctgtccttttaactgtgatcccaatggagagctatgtgacatatgt
aaagagagaaaaaaaagaggagagctaaaagttattaaaagaaaaatgaaggttgttaat
cttccaataggggctactgaagatagagttgttggaacccttgatattgagaaagccatt
aaagagggaataaaggctttagaaccagggatattagctgaagctaatagaaatatccta
tatattgatgaagtcaatttattagatgaccatattattgatctcctcttagatgctgct
gctatgggatggaatattattgagagagaaggaataagggttaaacatccatcaagattt
atcttagtaggaaccatgaacccagaggaaggggagttaaggcctcaaattttagataga
tttgggcttatggttgaagttgaaggactaagggatataaaagagagagttgaggttata
aagagagttgaagagttcaatgagaaccctgaagcattctataagaggtttgaagaagaa
caaaaaaaattaaaagagagaataataaaagcaagagaaattttaaagaatgttaaaata
aaggatgatctcttagaactcatttccaagatctgtttagagcttgggatccaaacaagt
agggcagatataacagtggttaggacagccaaggctatagctgcatttaatggtagagag
tatgtaaccttagatgacataaaagaggcttgtgagcttgctctaccccatagaatgaga
agaaaaccatttgagcctccaaggttagagaaagaaaggatagaggaaataataaataat
gagctaaaaaaaaactaa

DBGET integrated database retrieval system