KEGG   Methanocaldococcus infernus: Metin_0260Help
Entry
Metin_0260        CDS       T01234                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mif  Methanocaldococcus infernus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Metin_0260
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Metin_0260
Enzymes [BR:mif01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Metin_0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
241584..242498
Genome map
AA seq 304 aa AA seqDB search
MKHLISMRDIEREEIEEILEEANRMENLLNNKKPLKLLEGKILATIFYEPSTRTRLSFET
AMKRLGGEVITMDAKASSVAKGESLIDTVRVISGYSDIIVLRHPREGAARLAAKYSSVPI
INAGDGANQHPTQTLLDLYTIKRELGKIDNIRIAFIGDLKYGRTVHSLVYALSLFNNIEF
FFISPENLKIPEEIKEYLRRRGLRFKETKEFIDEEIDVLYVTRLQKERFTPEEYEKVKGS
YKITKEFVEGKNFIIMHPLPRVDEIDYEVDNLPNAKYFKQSYYGIPVRMAILYKLLRDSD
KALQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcatttaatatcaatgagagatatagagagggaagagattgaagaaattttagag
gaagctaataggatggagaacttattaaacaataaaaagcctttgaaacttcttgagggg
aagatattggcaactattttttatgagccatctacaaggacaaggcttagttttgaaaca
gctatgaagaggttgggaggagaagttataaccatggatgctaaagcttcatcagtggct
aagggagagagtttaatagacactgttagagtaatcagtggctactcagacattatagtc
ttaagacatccaagagaaggggctgcaagacttgcagctaagtattcttcagtccctata
ataaatgctggtgatggagctaaccagcatccaacacagacattattagatctatataca
ataaagagggaacttgggaagatagacaatataaggatagcctttattggagatctgaaa
tatggaaggactgttcattcattagtttatgctctctcactatttaataatattgaattc
ttctttatttctcctgaaaacttaaagattcctgaggagataaaagaatatttaagaaga
agagggttaagatttaaggaaactaaggagtttattgatgaagaaatagatgttctatat
gttacaaggctacaaaaagaaagatttactccagaggagtatgagaaggttaagggaagc
tataagataactaaggagtttgttgaagggaaaaactttattattatgcatcctctgcca
agggtagatgagatagattatgaagttgataatctaccaaatgccaaatactttaagcag
agctattatggaattcctgtaaggatggctatcctttataagttgcttagagattctgat
aaagctctccagtga

DBGET integrated database retrieval system