KEGG   Methanocaldococcus infernus: Metin_0260Help
Entry
Metin_0260        CDS       T01234                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mif  Methanocaldococcus infernus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mif00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mif00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
241584..242498
Genome map
AA seq 304 aa AA seqDB search
MKHLISMRDIEREEIEEILEEANRMENLLNNKKPLKLLEGKILATIFYEPSTRTRLSFET
AMKRLGGEVITMDAKASSVAKGESLIDTVRVISGYSDIIVLRHPREGAARLAAKYSSVPI
INAGDGANQHPTQTLLDLYTIKRELGKIDNIRIAFIGDLKYGRTVHSLVYALSLFNNIEF
FFISPENLKIPEEIKEYLRRRGLRFKETKEFIDEEIDVLYVTRLQKERFTPEEYEKVKGS
YKITKEFVEGKNFIIMHPLPRVDEIDYEVDNLPNAKYFKQSYYGIPVRMAILYKLLRDSD
KALQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcatttaatatcaatgagagatatagagagggaagagattgaagaaattttagag
gaagctaataggatggagaacttattaaacaataaaaagcctttgaaacttcttgagggg
aagatattggcaactattttttatgagccatctacaaggacaaggcttagttttgaaaca
gctatgaagaggttgggaggagaagttataaccatggatgctaaagcttcatcagtggct
aagggagagagtttaatagacactgttagagtaatcagtggctactcagacattatagtc
ttaagacatccaagagaaggggctgcaagacttgcagctaagtattcttcagtccctata
ataaatgctggtgatggagctaaccagcatccaacacagacattattagatctatataca
ataaagagggaacttgggaagatagacaatataaggatagcctttattggagatctgaaa
tatggaaggactgttcattcattagtttatgctctctcactatttaataatattgaattc
ttctttatttctcctgaaaacttaaagattcctgaggagataaaagaatatttaagaaga
agagggttaagatttaaggaaactaaggagtttattgatgaagaaatagatgttctatat
gttacaaggctacaaaaagaaagatttactccagaggagtatgagaaggttaagggaagc
tataagataactaaggagtttgttgaagggaaaaactttattattatgcatcctctgcca
agggtagatgagatagattatgaagttgataatctaccaaatgccaaatactttaagcag
agctattatggaattcctgtaaggatggctatcctttataagttgcttagagattctgat
aaagctctccagtga

DBGET integrated database retrieval system