KEGG   Methanocaldococcus infernus: Metin_0303Help
Entry
Metin_0303        CDS       T01234                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mif  Methanocaldococcus infernus
Brite
Enzymes [BR:mif01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Metin_0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
279595..280227
Genome map
AA seq 210 aa AA seqDB search
MDKYELIEKLKREGYIRSNSVEEALLKVPREEFVPEHLKDYAYCDTPLEIGHGQTISAPH
MVALMSELLELKPGMKVLEIGTGSGYHAAVTAELVGKDGLVVSIERIPELAERAEKTLRK
LGYDNVIVIVGDGSLGYKPLAPYDRIYCTAAAPSIPKSLISQLKDGGKMVIPVGKYMQKL
ILLEKRGDKIITKDYGAVAFVPLIGEEGFK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggataaatatgagcttattgagaagctaaagagagagggttatataagaagtaatagt
gtagaggaagctcttttaaaggttccaagggaagagtttgtcccagaacatttaaaagac
tatgcctactgtgacacccctttagaaattggtcatggtcagacaatttcagcccctcat
atggttgctttaatgtctgagcttttagagcttaagccagggatgaaggttttagaaatt
ggcactggctcaggctaccatgcagctgtcactgctgagcttgtgggaaaagatgggtta
gtggttagcatagagagaattccagagcttgcagagagggctgaaaaaaccttaagaaag
ttaggttatgataatgtaatagttatagttggagatggctctttaggatacaagccctta
gctccctatgatagaatttactgcacagctgcagctccttctatccctaagagtttaatt
agccaactaaaagatggaggaaaaatggttatccctgttgggaagtatatgcaaaagcta
atactattagagaagagaggggataagattataaccaaagactatggagctgtagccttt
gttccactcattggagaagagggatttaaataa

DBGET integrated database retrieval system