KEGG   Methanocaldococcus infernus: Metin_0334Help
Entry
Metin_0334        CDS       T01234                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mif  Methanocaldococcus infernus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metin_0334
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metin_0334
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metin_0334
Enzymes [BR:mif01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metin_0334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
306132..306950
Genome map
AA seq 272 aa AA seqDB search
MRIEEKFKELKEKGEKAFIAFYVGGDPSYEVSLEALKRICKYSDIVEIGIPFSDPVADGL
TIQKADIRALNAGMTPIKAFKLVEELNKFYPDVPKVFLTYYNIIFKMGEEEFVKRCKEAG
VAGIIVPDLPIEEANSLHEICEKYGVSLIFLVAPTTPDERIKKIVEKGSGFIYVVSTTGI
TGEREKLAKEAKETVERVKRYTDLPVCVGFGISKKEHVEEICKVADGAIVGSAIVKIVEK
NLNDKEKMLKEIEDFVKELKEGTKKKLLNKVS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaggatagaggagaagtttaaagaacttaaagagaagggagagaaagcctttatagcc
ttttatgttggaggagatccaagctatgaggtgtcattagaagctttaaaaagaatatgt
aaatactctgatatagttgaaattggaatccctttctcagatccagtagctgatggttta
actattcaaaaagctgacattagagcattgaatgcgggaatgacaccaataaaggcattt
aagttagtagaagagcttaataaattctatccagatgtgccaaaggtttttttaacctac
tacaatattatctttaagatgggagaagaagagtttgttaagagatgtaaagaggctgga
gttgcaggaataatagttcctgatctccctatagaagaagccaattctttacatgagatc
tgtgaaaagtatggagtaagcttaattttcttagtagctcctacaactcctgatgagagg
ataaagaagattgttgaaaagggaagtggctttatttatgttgtttcaaccactggaatt
actggagagagggagaagttagctaaggaagctaaggaaactgttgagagggttaagaga
tatacagatcttcctgtctgtgtaggttttggaatctctaagaaagagcatgtagaagag
atctgtaaggttgcagatggagctatagttggaagtgcaatagttaagatagttgagaaa
aatttaaatgataaggagaagatgctgaaggagattgaagattttgttaaagagcttaaa
gagggaacaaaaaagaagttacttaacaaagtttcttaa

DBGET integrated database retrieval system