KEGG   Methanocaldococcus infernus: Metin_0355Help
Entry
Metin_0355        CDS       T01234                                 

Definition
Fructose-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mif  Methanocaldococcus infernus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metin_0355
   01230 Biosynthesis of amino acids
    Metin_0355
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metin_0355
   00030 Pentose phosphate pathway
    Metin_0355
   00051 Fructose and mannose metabolism
    Metin_0355
  Energy metabolism
   00680 Methane metabolism
    Metin_0355
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metin_0355
Enzymes [BR:mif01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Metin_0355
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Metin_0355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
323137..324012
Genome map
AA seq 291 aa AA seqDB search
MDIKVPLTVPEYAKKEYISNYKELTKGTGRLMIFAGDQKIEHMNDDFFGEGIAKDDADPE
HLFRIASEGKICAFATQLGLIARYEEYGKVPYIVKINSKTHLVKTRDPISRALVTIQDVI
DLKERGVNILGVGYTIYPGSEYEHIMFREASKIILEAHKHGLIAILWSYPRGKNVKNEKD
PHLIAGAAGIALCLGADFVKVNYPGDSYKFKETILAAGRTGVLCAGGSKIEEEKFLKQIW
EQINISGAKGNATGRNIHQRPLEEAIKMCNAIYAITIEGKSWEEAIKILRG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggatattaaagttccccttactgtgccagagtatgctaagaaagaatatatttctaac
tataaagagctaaccaaagggacaggaaggttaatgatctttgctggagatcagaagata
gagcatatgaatgatgacttctttggggagggaatagctaaggatgatgctgatcctgag
catctctttaggatagcaagtgaaggaaagatttgtgcctttgctacccaacttggttta
attgcaagatatgaggaatatggaaaagttccttacatagttaagattaattcaaagact
catttagttaaaacaagggatccaataagtagagccttggttactattcaagatgtaata
gacttaaaggagaggggagttaatatcttaggagttggctacaccatttacccaggaagt
gagtatgagcatataatgttcagagaggcttcaaaaattatcttggaagctcataaacat
gggctaatagctattttgtggagttatccaagaggaaagaatgttaagaatgaaaaggat
cctcatttaatagctggagctgctgggatagctctatgcttaggagctgattttgttaag
gttaactatccaggagactcatacaagtttaaagaaactatattagctgctggaagaact
ggagttttatgtgctggaggtagcaagatagaagaagaaaaattcttaaagcaaatttgg
gagcaaattaatattagtggagctaagggaaatgctacaggaaggaatattcaccagagg
ccattagaagaagctataaaaatgtgtaatgcaatttatgctataaccattgaagggaag
agttgggaagaggctataaaaatattgagagggtaa

DBGET integrated database retrieval system