KEGG   Methanocaldococcus infernus: Metin_0376Help
Entry
Metin_0376        CDS       T01234                                 

Definition
(GenBank) alpha-L-glutamate ligase, RimK family
  KO
K15740  tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mif  Methanocaldococcus infernus
Pathway
mif00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Metin_0376
Enzymes [BR:mif01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     Metin_0376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK GSH-S_ATP ATP-grasp_3 ATPgrasp_ST ATPgrasp_YheCD DUF4343 CPSase_L_D2 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ADG13046
JGI: Metin_0376
UniProt: D5VR43
Position
complement(340509..341354)
Genome map
AA seq 281 aa AA seqDB search
MKLGIVSLEKDDVVLSLMKACEEKGVDYRLIDPRHITIDIHERIVKYYKTNLLNMDCFFI
RNIGWEWHRSDVLKYLANFVPTINKPEVIDICGNKLLTTIYLDKFNFPQPKTLITENEND
ALLFIEEVGDVVVKPIFGHGGEGIHKIKEDMPIASKVSLLRNLKKVNKVLYIQEYINSDR
DIRAFFIDNKIYCMYRYGKSWKHNVSQGAEVEPCKAYEKMKKLVLDIKEKFGLFYGGVDL
IEKGNKLLVLEVNATPSWIAISKAHEVNLASILLDNIIKQI
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttggaattgtaagtttagagaaggatgatgttgtcctctctcttatgaaggct
tgtgaggagaaaggagttgattataggttaattgatccaaggcatataaccattgatata
catgagagaattgttaagtactataaaactaacttgctaaatatggactgcttttttata
agaaatattggatgggaatggcacaggagtgatgtcttaaaatatttggcaaattttgtt
ccaaccattaataagccagaggttatagatatctgtggaaataagttactgacaactata
tacttagataaatttaattttcctcaaccaaagacattgataactgaaaatgaaaatgat
gctctcctctttatagaggaggttggagatgttgttgtaaagccaatatttggacatggt
ggggaaggaatacataagataaaagaggacatgccaatagcttctaaggtttctttatta
agaaatctgaagaaggttaataaagttttatatattcaagagtatataaatagtgataga
gatataagagctttctttattgacaataaaatttactgtatgtatagatatggaaaaagt
tggaagcacaatgttagccaaggggctgaagtagagccatgtaaagcctatgaaaaaatg
aaaaaattagtcttagacattaaagagaagtttggactcttttatggtggagtagactta
atagaaaaagggaataaattgttagtgttggaggttaatgctactccatcttggatagct
atatctaaggctcatgaggttaacttagcctctattttgttagataacataatcaaacaa
atataa

DBGET integrated database retrieval system