KEGG   Methanocaldococcus infernus: Metin_0380Help
Entry
Metin_0380        CDS       T01234                                 

Definition
(RefSeq) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mif  Methanocaldococcus infernus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metin_0380
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Metin_0380
   00640 Propanoate metabolism
    Metin_0380
   00660 C5-Branched dibasic acid metabolism
    Metin_0380
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metin_0380
Enzymes [BR:mif01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Metin_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(343689..344777)
Genome map
AA seq 362 aa AA seqDB search
MKLHEYEAKKIFKKYGIDVPKSFLIKKGDDVELKEFDEAVLKAQVLVGGRGKAGGILFTN
KENFKEKVEELFNKEIKGEKVDKILVEEKLRIKKEYYLSITIDRNEKKPVIIFSSEGGVD
IEEIAEKHPEKIIKYYVDIKKPFLPYIGREIAKKAGVEIKVGDIIYKVYKIFKELDATLV
EINPLVITEDNKIYAADAVIHLDDDSYFRQDFSEFEEYKNKENLPFAYVELDGDVAVIGN
GAGLTLASMDTIYDFGLKPACFLDIGGGADEETTKLALKKVLENKKVKGIFINVLGGITR
CDEVAKAIVEILKDNPNIKFSVRLTGTNEELGRKILEEANIPYSTSMYEAGKRLAESLRF
SL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttacatgaatatgaagccaaaaaaatctttaaaaagtatggaattgatgttcca
aaaagctttttgataaagaaaggggatgatgtggaattaaaagaatttgatgaagctgtg
ctaaaggctcaagttttagtaggtggaagaggaaaagctggaggaatcttatttacaaac
aaggaaaactttaaggaaaaggttgaagagctctttaataaagagataaagggagaaaaa
gttgataaaatattggttgaagagaagctaaggataaaaaaagagtattatttatcaata
accattgatagaaatgagaaaaagccagttattattttctcctctgagggtggtgtagat
atagaagaaattgctgagaaacatcctgagaaaattattaaatactatgtagatataaaa
aagcccttccttccatacattggaagagagatagctaaaaaggctggagttgagattaaa
gttggagatattatctacaaagtttataagatctttaaagagcttgatgctacccttgtt
gaaattaacccattggttataactgaagataataaaatttatgctgctgatgctgtcata
cacttagatgatgactcttactttagacaggactttagtgaatttgaagagtataaaaat
aaggagaatttgccatttgcctatgttgagcttgatggagatgttgcagtcattggtaat
ggagctggcttaacattggcaagtatggatacaatctatgactttggcttaaagccagct
tgcttcttagacattggtggaggggctgatgaagaaactactaagttagctttaaagaag
gttttggagaataaaaaagttaaagggatctttataaatgtccttggtggaataacaagg
tgtgatgaagtagctaaggcaattgtagaaatcttaaaagataatccaaatattaagttc
tctgtcagattaacaggaactaatgaagagttaggaagaaaaattttagaagaggccaat
attccttactccacatctatgtatgaagctgggaaaagattggctgagagtttaaggttt
tctctttaa

DBGET integrated database retrieval system