KEGG   Methanocaldococcus infernus: Metin_0391Help
Entry
Metin_0391        CDS       T01234                                 

Definition
Indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mif  Methanocaldococcus infernus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mif01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mif00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
354119..354910
Genome map
AA seq 263 aa AA seqDB search
MSNTLKEILAERKKLIEMEKRSNILEDIRKLKEELGVERKRISLRKKIKLCNDRYPIITE
IKPKSPSKGRIMEIKEEDVKEIAEKMKRGGAIGISVLTEPKFFGGSYRNLVYAKLSKLPI
LMKDFVIDKYQLDIANEISDSVLLIVSALKERLGEFLDYADDLNLEPLVEVHNEEELDLA
LDFGAKLIGINSRDLKTLKIDLNTIKRLAPLIPKKVVKVGESGIYKKEELVEMFNYVDGY
LIGSSIMESDDIERKVKELSSKE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatacattaaaagaaatcttagctgagagaaaaaagcttattgagatggagaaa
aggagtaatattttagaagatattaggaaacttaaggaagagttaggagtagaaagaaaa
agaattagtttaaggaaaaaaataaagctttgtaatgatagatatcctataattactgag
ataaagccaaagtcaccatcaaaaggtaggataatggaaattaaagaggaagatgttaaa
gaaattgctgaaaagatgaaaaggggaggggctataggaatttcagttctaacagagcct
aagttttttggagggagttatagaaatttagtttatgctaagctttccaagcttcctatt
ttgatgaaagactttgttattgataagtatcagttagatatagctaatgagatctctgac
tctgtacttctaatagtttcagctctaaaagagagattaggggaattcttagactatgct
gatgatctcaacttagagcctcttgttgaagtgcataatgaggaagagttagacttagcc
ttagactttggagccaagcttattggaataaatagcagggacttaaaaaccttaaagata
gatctaaatactataaagaggttagctcctctcattcctaagaaagttgttaaagttgga
gagagtgggatctataaaaaggaggaattggttgagatgttcaactatgtagatggctat
ttaattggctcatcaattatggaaagtgatgatattgagagaaaggttaaagagcttagc
tcaaaagagtaa

DBGET integrated database retrieval system