KEGG   Methanocaldococcus infernus: Metin_0522Help
Entry
Metin_0522        CDS       T01234                                 

Definition
Alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mif  Methanocaldococcus infernus
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mif00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:mif02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
472877..474361
Genome map
AA seq 494 aa AA seqDB search
MKKFLAILLISLLLASGLSFALSNKPIEGRAKNVIVLIGDGMGISQVYITKLCYGHLAME
DFPYSGYEMTNSLSGEVTDSAAAGTAIATGFKTYNKIISQVKNNGKYYNVTTLLELAKKL
DKATGLVTTTRITHATPAVFGAHVENRDMEKEIAKQYLEKKINVLLGGGKEEFSNELLEK
YKEEGYEIVYNKDQLEKANSKYLLGLFSDSHIPYVLDRNEDVPSLLDMTKKAIEILEKNP
NGFFLMVEGGRIDHACHGNDIASVVAETKEFDDVVRYCLNYAKKRGDTLVIVLADHETGG
LGLGLNYGDSIDEDKILNIKASAYRMAKLIKEGADPKTVLKTYANIELNKDELQKIDEAL
KSTNKYALSNTIAEIIDERVGVKFISHKHTAVPVPLLAYGPGAEDFMGFHHHVDTSKLVA
KDMLFRGDYAVSIKGITHVKGDANGDFKVDKEDAYITLLYYVGNFANTDQEKLLDMDNNG
VIDYNDVYLILEQS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattcttagctatacttttaatatctcttctcttagcatcaggtttaagtttc
gctctctcaaataagccaatagaaggaagggctaagaatgttatagtcttaattggagat
ggaatgggaatttcccaagtttatataactaagctctgctatggacatttagcaatggaa
gactttccatattctggctatgagatgactaattctttaagtggtgaagttactgattca
gctgcagctgggacagctatagcaactggatttaagacctacaataagattatctcacag
gttaagaataatgggaaatattacaatgtaacaactctcttagagttggctaagaaatta
gacaaagctacaggattggttacaactacaagaataacacatgctactccagcagtgttt
ggagctcatgttgaaaatagagatatggaaaaagaaatagctaagcaatacttggagaaa
aaaattaatgtccttttaggtggaggaaaagaggaattttctaatgagttgttggagaaa
tataaagaagaaggttatgaaatagtttataataaagatcagctggaaaaggctaacagc
aaatacttgttaggactattttcagatagccatattccttatgttttagatagaaatgaa
gatgtaccaagcttgttagacatgactaaaaaggctatagagatattggagaaaaatcct
aatggtttcttcttaatggttgaaggtggaagaatagatcatgcatgtcatggaaatgac
atagcttcagtggtagctgaaactaaggagtttgatgatgttgtcagatactgcttaaac
tatgccaaaaagagaggagatactttagttattgtcttagctgaccatgaaactgggggc
ttaggtttaggattaaactatggagactctatagatgaggacaaaattttaaatatcaag
gcttcagcctatagaatggctaagcttattaaagaaggagcagatcctaagacagtttta
aagacttatgccaatatagagctaaataaagatgaattacaaaaaattgatgaggcttta
aaatcaactaataagtatgcactctcaaataccatagctgagattattgatgagagagta
ggggttaaatttatctcccataagcatacagctgttcctgtcccactcttagcctatggt
ccaggagcagaggactttatgggcttccatcaccatgtagatacaagtaagttagtggct
aaagatatgctatttagaggagactatgctgtctctataaaaggaattacccatgttaaa
ggagatgcaaatggagactttaaagtagataaggaagatgcttatataaccttattatac
tatgtaggaaactttgcaaacactgatcaggaaaaattattagatatggacaacaatgga
gttattgactacaatgatgtctacctcatcttagagcaatcctaa

DBGET integrated database retrieval system