KEGG   Methanocaldococcus infernus: Metin_0522Help
Entry
Metin_0522        CDS       T01234                                 

Definition
Alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mif  Methanocaldococcus infernus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Metin_0522
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Metin_0522
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Metin_0522
Enzymes [BR:mif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Metin_0522
Exosome [BR:mif04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Metin_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
472877..474361
Genome map
AA seq 494 aa AA seqDB search
MKKFLAILLISLLLASGLSFALSNKPIEGRAKNVIVLIGDGMGISQVYITKLCYGHLAME
DFPYSGYEMTNSLSGEVTDSAAAGTAIATGFKTYNKIISQVKNNGKYYNVTTLLELAKKL
DKATGLVTTTRITHATPAVFGAHVENRDMEKEIAKQYLEKKINVLLGGGKEEFSNELLEK
YKEEGYEIVYNKDQLEKANSKYLLGLFSDSHIPYVLDRNEDVPSLLDMTKKAIEILEKNP
NGFFLMVEGGRIDHACHGNDIASVVAETKEFDDVVRYCLNYAKKRGDTLVIVLADHETGG
LGLGLNYGDSIDEDKILNIKASAYRMAKLIKEGADPKTVLKTYANIELNKDELQKIDEAL
KSTNKYALSNTIAEIIDERVGVKFISHKHTAVPVPLLAYGPGAEDFMGFHHHVDTSKLVA
KDMLFRGDYAVSIKGITHVKGDANGDFKVDKEDAYITLLYYVGNFANTDQEKLLDMDNNG
VIDYNDVYLILEQS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattcttagctatacttttaatatctcttctcttagcatcaggtttaagtttc
gctctctcaaataagccaatagaaggaagggctaagaatgttatagtcttaattggagat
ggaatgggaatttcccaagtttatataactaagctctgctatggacatttagcaatggaa
gactttccatattctggctatgagatgactaattctttaagtggtgaagttactgattca
gctgcagctgggacagctatagcaactggatttaagacctacaataagattatctcacag
gttaagaataatgggaaatattacaatgtaacaactctcttagagttggctaagaaatta
gacaaagctacaggattggttacaactacaagaataacacatgctactccagcagtgttt
ggagctcatgttgaaaatagagatatggaaaaagaaatagctaagcaatacttggagaaa
aaaattaatgtccttttaggtggaggaaaagaggaattttctaatgagttgttggagaaa
tataaagaagaaggttatgaaatagtttataataaagatcagctggaaaaggctaacagc
aaatacttgttaggactattttcagatagccatattccttatgttttagatagaaatgaa
gatgtaccaagcttgttagacatgactaaaaaggctatagagatattggagaaaaatcct
aatggtttcttcttaatggttgaaggtggaagaatagatcatgcatgtcatggaaatgac
atagcttcagtggtagctgaaactaaggagtttgatgatgttgtcagatactgcttaaac
tatgccaaaaagagaggagatactttagttattgtcttagctgaccatgaaactgggggc
ttaggtttaggattaaactatggagactctatagatgaggacaaaattttaaatatcaag
gcttcagcctatagaatggctaagcttattaaagaaggagcagatcctaagacagtttta
aagacttatgccaatatagagctaaataaagatgaattacaaaaaattgatgaggcttta
aaatcaactaataagtatgcactctcaaataccatagctgagattattgatgagagagta
ggggttaaatttatctcccataagcatacagctgttcctgtcccactcttagcctatggt
ccaggagcagaggactttatgggcttccatcaccatgtagatacaagtaagttagtggct
aaagatatgctatttagaggagactatgctgtctctataaaaggaattacccatgttaaa
ggagatgcaaatggagactttaaagtagataaggaagatgcttatataaccttattatac
tatgtaggaaactttgcaaacactgatcaggaaaaattattagatatggacaacaatgga
gttattgactacaatgatgtctacctcatcttagagcaatcctaa

DBGET integrated database retrieval system