KEGG   Methanocaldococcus infernus: Metin_0729Help
Entry
Metin_0729        CDS       T01234                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
mif  Methanocaldococcus infernus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(655254..656297)
Genome map
AA seq 347 aa AA seqDB search
MVIEYLKKLSELHGISGREDSVREFMKEELEKYCEVEIDKFGNLIAKKGEGEKSLMLAAH
MDEIGLMVKYIDDNGFLKFTKIGGIYDPTILNQKVVVHGRKGDIIGVLGSKPPHRMKEEE
RNKLIKYEDMFIDIGAESREEAMEMGVRIGTWVSFLTEVHELGKHRLTGKAFDDRVGCSI
LLDVMRNLPDDLDFKVYAVGTVQEEVGLKGAKVSAFKLNPDMAIALDVTISGDHPGIKKE
DAPVELGKGPVVGIVDASGRGLIAHPRVLELIEEVSLKYNIEVQWEVGEGGTTDATAIHL
AREGIPTGVISVPARYIHTPVEVIDKRDLKKTSELVLKTILEFPNFF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggttatagagtatcttaaaaaactttcagagcttcatgggatctctggaagagaggac
agtgttagagagttcatgaaggaagagcttgaaaaatattgtgaagttgaaatagataag
tttggaaatttaatagctaagaagggagaaggagagaagagcttaatgcttgctgcacac
atggatgagattggattaatggttaagtatattgatgacaatggatttttaaagttcacc
aagataggaggaatctatgatccaacaattctaaaccagaaggttgtagttcatggaagg
aaaggagatataataggggttcttggctctaagcctcctcatagaatgaaagaggaagag
agaaataaattaataaaatatgaagacatgttcatagacattggtgcagagagtagagag
gaagccatggagatgggggttagaataggaacatgggtttccttcttaactgaggttcat
gagcttggaaagcataggttaacagggaaagcctttgatgacagagttggatgctcaatc
ttacttgatgttatgagaaacttacctgatgacttagactttaaagtctatgctgttgga
acagttcaggaagaggttggactaaagggagccaaggtttcagcctttaagcttaatcca
gacatggctatagctttagatgttactatatctggggatcatccagggattaaaaaagaa
gatgctcctgttgagcttggcaaggggccagttgttggcatagttgatgcctctggaaga
ggtttaatagctcatccaagggttttagagcttatagaagaggtttctttaaagtataat
atagaggttcagtgggaagttggagagggaggaacaactgacgctacagccatacattta
gcaagggagggaattcctacaggagttatttcagtgccagcaaggtatatacatactcca
gttgaagttattgacaaaagagatttaaagaagacatctgagttagtcttaaaaactatt
cttgagttcccaaacttcttttaa

DBGET integrated database retrieval system