KEGG   Methanocaldococcus infernus: Metin_0751Help
Entry
Metin_0751        CDS       T01234                                 

Definition
(RefSeq) AMP phosphorylase
  KO
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
mif  Methanocaldococcus infernus
Brite
Enzymes [BR:mif01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     Metin_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(674534..676039)
Genome map
AA seq 501 aa AA seqDB search
MLFLKVRLLDIDLLDLVLINPEDIKASQYFPGDRVVLIYKNKEEIGTIYSSTLVNRGEIG
ITKELAKSLKVKEGELITIKHADKPRSLAYIKKKMDKNKLSKEEIFLIVDEMVNNKLTNI
EISAFVTSLYINGMDMDEIEALTIRMAETGEMVEWESLVFDVHSIGGVPGNKYALLTVPI
VASAGLKIPKTSSRAITSAAGTADVMEVLTRVDLSIEEIKNVVKETNGCLVWGGALNLAP
ADDITINVERPLGIDPKPLLLSSVMAKKLAMGVSKLLIDIPIGREVKVKDEKEGNKLARE
FIELGERLNITTECALTYGNQPIGRAIGPALEAKEALETLEDPYKGANSLVDKATHLAGI
LLEMGGIAPAGEGKEVAEELLFRKAHDKFMDIIVAQGGKEVRSEEIEVGKYFIDIVSPKD
GYVIELSNNKITKIAKEAGAPNDKKAGVYLNVKVGDKVEKGDLLFTIYSSSEDRLKNAIK
LARTLYPIKVEGILIKRIVRF
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
ttgttattcctaaaggttaggttattagatatagatttattagacttagtattaataaat
cctgaggatattaaagcttctcaatattttccaggagatagggttgtcttaatatacaaa
aataaggaagagataggaactatttattcctctacattagttaataggggagagataggg
ataactaaagagttggctaagagtttaaaggttaaggaaggggagttaataactataaaa
catgctgacaagccaagaagcttagcctacataaagaaaaagatggataagaataagtta
agtaaggaagagatattcttaattgttgatgaaatggttaataataagctaacaaatatt
gagatctctgcctttgtcacctctctctacataaatggcatggatatggatgagattgaa
gctttaaccataaggatggctgagactggagagatggttgaatgggaaagcttggttttt
gatgtccactccataggaggagttcctgggaataagtatgctcttctaacagtccctatt
gtagcttcagctgggctgaagattcctaaaacttcttcaagagctattacttcagcagca
ggaacagctgatgttatggaagttctaacaagggttgatttaagtatagaagaaattaaa
aatgttgtgaaagaaactaatggatgtttagtttggggtggagctttaaacttggctcca
gctgatgacataaccataaatgttgaaagacctcttgggatagaccctaagcctctatta
ttatcaagtgtcatggctaaaaaattggctatgggagttagtaaattattgatagacatc
cctattggaagagaggttaaggttaaggatgagaaagaggggaacaagttagcaagagag
tttatagagcttggggagaggttaaatattactactgaatgtgccttaacctatggaaac
caaccaattggcagagccatagggccagctttagaggcaaaagaggctttagaaacctta
gaagatccttataaaggtgcaaatagcttagttgataaagctacccacttagctggcatc
ctattagagatgggagggatagctccagctggagaagggaaagaagtggctgaagagcta
ttatttagaaaggctcatgacaagtttatggacataatagtggctcagggtggaaaggag
gtaagaagtgaagagattgaagtagggaagtattttatagatattgtctctccaaaggat
ggttatgtaattgaattatcaaataataagataacaaagatagctaaagaggctggagct
ccaaatgataaaaaggctggtgtttatttaaatgtgaaggttggagataaagtagagaaa
ggagaccttttatttaccatttactcaagctccgaagataggttaaagaatgctataaag
ctggcaagaactttatatcctataaaggttgaaggtatcttaataaaaagaattgtaaga
ttttaa

DBGET integrated database retrieval system