KEGG   Methanocaldococcus infernus: Metin_0902Help
Entry
Metin_0902        CDS       T01234                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mif  Methanocaldococcus infernus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Metin_0902
   00052 Galactose metabolism
    Metin_0902
   00500 Starch and sucrose metabolism
    Metin_0902
   00520 Amino sugar and nucleotide sugar metabolism
    Metin_0902
Enzymes [BR:mif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Metin_0902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
806718..807563
Genome map
AA seq 281 aa AA seqDB search
MINKAVIPVAGFGTRLLPITKAQPKEMLPVVNKPIVQYVVEDLVEAGVKNILFVTGKGKQ
AIENHFDANYELECKLEKSGKLDKLEELKRINNLGNIFYVRQKEPRGLGDAILHGESFVG
DEYFIAMVGDTIYSKNIVKDLIKAYEKYNCSIIALERVPKEEVYKYGVIDGEEIEKGVYK
INNMVEKPKVEEAPSNLIITGAYLFSPKIFKKIKETKPGRGGEIQITDAMNLLLKEEEII
GIEINCKRYDIGDPLGWLKANIEIGIEMFPELKEFLKELIK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgattaacaaggctgttatccctgtagctggatttgggacaaggctgttaccaataacc
aaagctcagcctaaagagatgttgccagttgtcaataagccaatagttcagtatgtggtt
gaggatcttgtagaggctggagttaaaaatattttatttgttactgggaaagggaagcaa
gctattgagaatcattttgatgccaattatgagttagagtgtaagttagagaaaagtgga
aagttggataagcttgaagagcttaaaagaataaacaacttaggaaatatattctatgtt
agacagaaggagccaagaggtttaggagacgctatactacatggagaaagctttgttggg
gatgagtattttatagccatggttggagatacaatttactcaaaaaatatagttaaagat
ctaataaaggcttatgaaaaatataactgctctatcatagccttggagagagttcctaag
gaagaggtttataagtatggagttatagatggagaggaaatagagaaaggagtttataag
ataaataacatggttgaaaagccaaaggttgaggaggctccatcaaatttaataataact
ggagcctatcttttttctccaaagatatttaagaaaattaaagaaactaaaccaggaaga
ggaggggagatacagataactgatgctatgaacctactattaaaggaagaggagataata
gggattgaaattaactgtaaaagatatgacattggagatccattaggttggttaaaagct
aatatagagataggaattgagatgttcccagagttaaaagaatttttaaaagagctaata
aagtga

DBGET integrated database retrieval system