KEGG   Methanocaldococcus infernus: Metin_0953Help
Entry
Metin_0953        CDS       T01234                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase, type II (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mif  Methanocaldococcus infernus
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mif01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mif01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mif00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
856264..857295
Genome map
AA seq 343 aa AA seqDB search
MKAKVLINGYGSIGKRVADAVSAQKDMEVIGVTKTKPDFDAKLATELGYKLYCAIPDKER
VKAFEEAGIPIEGTILDVIEEADIVVDGAPKKVGKENLEKIYKPNKVKAILQGGEKAKDV
EDNFNALWSYERCYGKSYVRVVSCNTTGLCRILYALKDFGIKKARVVLVRRGADPNDDKT
GPINAIKPNPVTVPSHHGPDVVSVVPELKDKIITSAVIVPTTLMHQHTLMVEVESEVKRE
DILEKINETPRIILVREKEGFSSTAKIIEFARDLGRKRYDLPELCVWEESVNTLGNEIFL
MQAVHQESIVVPENIDCIRAMLEMEDDKFKSIEKTNKALNLIK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctaaggttttgataaatggctatggctctattgggaagagggtagctgatgca
gtctcagctcagaaggatatggaggttattggagttacaaagacaaagccagactttgat
gctaagttagccactgagttaggctataagttatattgtgccatcccagataaagagaga
gtaaaagcctttgaagaagctggaattcctatagaaggaactatcttagatgtgattgaa
gaggctgacattgttgtagatggggctccaaagaaggtagggaaggaaaacttagagaag
atatataagccaaataaggttaaggctattttgcaaggtggtgagaaggctaaggatgtt
gaagataactttaatgccctctggagctatgaaagatgctatggtaagagctatgttaga
gttgtttcctgtaacacaactggtttatgtagaatcttatatgctctaaaagactttggg
ataaaaaaggcaagagttgttttagttaggagaggagcagatccaaatgatgataaaact
ggaccaataaatgctattaagccaaatcctgtaactgttccttctcaccatggtccagat
gtagtttcagtagttccagagcttaaagataagataataacttcagctgtaatagttcca
accaccttaatgcatcaacacaccctaatggttgaggttgagagtgaagttaaaagagaa
gacattttagagaaaattaatgaaactccaaggataatattggttagagaaaaagaagga
tttagctcaacagccaaaattatagagtttgcaagagacttaggtaggaaaagatatgat
cttccagagttatgtgtctgggaagagagtgttaataccttaggaaatgaaatattctta
atgcaagctgtccatcaagagagtatagtggtccctgaaaatatagattgtataagagct
atgttagagatggaagatgataagtttaaatctatagagaagacaaataaagctctaaac
ttaataaaataa

DBGET integrated database retrieval system