KEGG   Methanocaldococcus infernus: Metin_1025Help
Entry
Metin_1025        CDS       T01234                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mif  Methanocaldococcus infernus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metin_1025
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metin_1025
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Metin_1025
Enzymes [BR:mif01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Metin_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(923080..924288)
Genome map
AA seq 402 aa AA seqDB search
MIYQRCIECGKTYEDDEIVYRCECNGLLEIVYDFDKIEVDKEKFKNRVFSVWRYFELLPI
KNREKIISLKEGGTPLYRCRNLEEELGVKELYVKNEGANPTGSFKDRGMTVGVSKANELN
IKVVGCASTGNTSASLAAYSARAKMKCLVLLPKGKVALGKLAQAMIYGAKVVEIDGNFDK
ALDMVNELAKEGLIYLLNSINPFRLEGQKTIGYEIADELNWEVPDRVIVPVGNAGNISAI
WKGFKEFYELGFINELPKMTGIQAEGAKPIVEAFKKGKREIEPYENPETIATAIRIGKPV
NAKKALNAIYESNGYAESVSDEEIIKAQKLLARKEGIFVEPASASSIAGLIKLLDEGVID
RSERIVCITTGHGLKDPDAAIRACEETIKVKSLDELKKLLSS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgatatatcagagatgtatagagtgtggaaaaacctatgaagatgatgagattgtttat
aggtgtgagtgcaatggtttattggagatagtttatgactttgacaagatagaggttgat
aaagagaagtttaaaaatagagtttttagtgtttggagatactttgagctcttaccaata
aaaaatagggagaagataattagcctaaaagagggaggaactcctctttataggtgtaga
aacttagaggaagagttaggggttaaagagctttatgttaaaaatgaaggagctaatcca
acagggagctttaaagatagagggatgacagtaggagtttctaaggcaaatgaattaaat
ataaaggttgttggctgtgcttccactggaaatacttcagcctccttagctgcttactca
gcaagggctaagatgaaatgcttagtcttactacctaaaggaaaagtagccttaggaaag
ttggctcaagctatgatatatggagctaaggttgttgagattgatggaaactttgacaaa
gccttagatatggttaatgaactggctaaagagggattaatttatttattgaactctata
aatccatttagattggaagggcaaaagactataggctatgagattgctgatgagctaaac
tgggaagttcctgatagggttatagtccctgtagggaatgctggaaacatatcagctatt
tggaaagggtttaaagagttctatgagcttggctttataaatgagcttccaaaaatgaca
ggaattcaggcagagggagctaagccaatagttgaggcattcaaaaaagggaagagagag
atagagccttatgaaaatcctgagactatagctactgctataaggatagggaagccagtt
aatgctaaaaaggctttaaatgctatctatgagtctaatggctatgctgagtcagttagt
gatgaagaaattattaaagctcaaaagttattagcaagaaaagagggaatctttgtagag
ccagcttcagcctcttcaatagctggcttaattaagctattggatgagggagttattgac
aggagtgagagaattgtttgtataaccacaggacatggtttaaaggatccagatgctgct
ataagggcttgtgaagaaaccattaaggttaaatccttagatgagcttaagaagttatta
agctcttaa

DBGET integrated database retrieval system