KEGG   Methanocaldococcus infernus: Metin_1025Help
Entry
Metin_1025        CDS       T01234                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mif  Methanocaldococcus infernus
Pathway
mif00260  Glycine, serine and threonine metabolism
mif00750  Vitamin B6 metabolism
mif01100  Metabolic pathways
mif01110  Biosynthesis of secondary metabolites
mif01120  Microbial metabolism in diverse environments
mif01230  Biosynthesis of amino acids
Module
mif_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metin_1025
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Metin_1025
Enzymes [BR:mif01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Metin_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADG13683
JGI: Metin_1025
UniProt: D5VSY0
Position
complement(923080..924288)
Genome map
AA seq 402 aa AA seqDB search
MIYQRCIECGKTYEDDEIVYRCECNGLLEIVYDFDKIEVDKEKFKNRVFSVWRYFELLPI
KNREKIISLKEGGTPLYRCRNLEEELGVKELYVKNEGANPTGSFKDRGMTVGVSKANELN
IKVVGCASTGNTSASLAAYSARAKMKCLVLLPKGKVALGKLAQAMIYGAKVVEIDGNFDK
ALDMVNELAKEGLIYLLNSINPFRLEGQKTIGYEIADELNWEVPDRVIVPVGNAGNISAI
WKGFKEFYELGFINELPKMTGIQAEGAKPIVEAFKKGKREIEPYENPETIATAIRIGKPV
NAKKALNAIYESNGYAESVSDEEIIKAQKLLARKEGIFVEPASASSIAGLIKLLDEGVID
RSERIVCITTGHGLKDPDAAIRACEETIKVKSLDELKKLLSS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgatatatcagagatgtatagagtgtggaaaaacctatgaagatgatgagattgtttat
aggtgtgagtgcaatggtttattggagatagtttatgactttgacaagatagaggttgat
aaagagaagtttaaaaatagagtttttagtgtttggagatactttgagctcttaccaata
aaaaatagggagaagataattagcctaaaagagggaggaactcctctttataggtgtaga
aacttagaggaagagttaggggttaaagagctttatgttaaaaatgaaggagctaatcca
acagggagctttaaagatagagggatgacagtaggagtttctaaggcaaatgaattaaat
ataaaggttgttggctgtgcttccactggaaatacttcagcctccttagctgcttactca
gcaagggctaagatgaaatgcttagtcttactacctaaaggaaaagtagccttaggaaag
ttggctcaagctatgatatatggagctaaggttgttgagattgatggaaactttgacaaa
gccttagatatggttaatgaactggctaaagagggattaatttatttattgaactctata
aatccatttagattggaagggcaaaagactataggctatgagattgctgatgagctaaac
tgggaagttcctgatagggttatagtccctgtagggaatgctggaaacatatcagctatt
tggaaagggtttaaagagttctatgagcttggctttataaatgagcttccaaaaatgaca
ggaattcaggcagagggagctaagccaatagttgaggcattcaaaaaagggaagagagag
atagagccttatgaaaatcctgagactatagctactgctataaggatagggaagccagtt
aatgctaaaaaggctttaaatgctatctatgagtctaatggctatgctgagtcagttagt
gatgaagaaattattaaagctcaaaagttattagcaagaaaagagggaatctttgtagag
ccagcttcagcctcttcaatagctggcttaattaagctattggatgagggagttattgac
aggagtgagagaattgtttgtataaccacaggacatggtttaaaggatccagatgctgct
ataagggcttgtgaagaaaccattaaggttaaatccttagatgagcttaagaagttatta
agctcttaa

DBGET integrated database retrieval system