KEGG   Methanocaldococcus infernus: Metin_1041Help
Entry
Metin_1041        CDS       T01234                                 

Definition
(GenBank) branched-chain amino acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
mif  Methanocaldococcus infernus
Pathway
mif00270  Cysteine and methionine metabolism
mif00280  Valine, leucine and isoleucine degradation
mif00290  Valine, leucine and isoleucine biosynthesis
mif00770  Pantothenate and CoA biosynthesis
mif01100  Metabolic pathways
mif01110  Biosynthesis of secondary metabolites
mif01130  Biosynthesis of antibiotics
mif01210  2-Oxocarboxylic acid metabolism
mif01230  Biosynthesis of amino acids
Module
mif_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Metin_1041
   00280 Valine, leucine and isoleucine degradation
    Metin_1041
   00290 Valine, leucine and isoleucine biosynthesis
    Metin_1041
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Metin_1041
Enzymes [BR:mif01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     Metin_1041
Amino acid related enzymes [BR:mif01007]
 Aminotransferase (transaminase)
  Class IV
   Metin_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4 DUF658
Motif
Other DBs
NCBI-ProteinID: ADG13699
JGI: Metin_1041
UniProt: D5VSZ6
Position
939190..940047
Genome map
AA seq 285 aa AA seqDB search
MKIYLNGKFVPKEEAKVSVFDHGLLYGDGVFEGIRAYDGNVFMLKEHIDRLYDSAKSICL
DIPLTKEEMIDVVLETLRVNNLKDAYIRLVVTRGEGDLGLDPRKCKEPSIICIAIPMPPL
LGEEGIRAITVSVRRPPIDVLNPAVKSLNYLNSVLAKILANYANVDEALLLDKEGYVVEG
TGDNIFVVKNGVLKTSPPYLSILKGITRDVVIKLAKEEGIEVREEPITLHDLYTADELFI
TGTAAEIVPIFEIDGRIINNKKVGEITKRLRERFKEIRTKWGIKI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatctatttaaatggaaaatttgttcccaaggaagaggctaaggtttcagttttt
gaccatggtttactctatggagatggagtttttgagggaataagggcttatgatggaaat
gtgttcatgctgaaagagcatattgataggttatatgactcagcaaaatccatctgttta
gatattcctctcacaaaggaggaaatgatagatgtggttttagaaacacttagggttaac
aatttaaaagatgcttatataaggcttgtagttacaagaggggaaggagacttaggctta
gacccaaggaagtgtaaggagccaagtattatatgtatagccatccctatgcctcctctc
ttgggagaggaagggattagggctataaccgtctctgtaagaaggcctccaatagatgtt
ttaaatccagctgttaaatctctaaattacttaaatagtgtcttagccaaaattttggct
aactatgcaaatgttgatgaagctctccttttagataaagagggttatgttgttgagggt
actggagacaatatctttgttgtcaaaaatggggttttaaaaacttctccaccatactta
agtatattgaaggggataacaagagatgttgttataaagttggctaaagaggaaggaata
gaggttagggaagagccaataactttacatgatctatatactgctgatgaactctttatc
actggaacagctgctgagatagttccaatctttgaaatagatggaagaattataaataat
aaaaaagttggagagataacaaagaggttaagggagagatttaaagagattagaaccaaa
tggggaataaaaatataa

DBGET integrated database retrieval system