KEGG   Methanocaldococcus infernus: Metin_1041Help
Entry
Metin_1041        CDS       T01234                                 

Definition
branched-chain amino acid aminotransferase (EC:2.6.1.42)
Orthology
K00826  
branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
mif  Methanocaldococcus infernus
Pathway
Valine, leucine and isoleucine degradation
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Metin_1041
   01230 Biosynthesis of amino acids
    Metin_1041
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Metin_1041
   00290 Valine, leucine and isoleucine biosynthesis
    Metin_1041
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Metin_1041
Enzymes [BR:mif01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     Metin_1041
Amino acid related enzymes [BR:mif01007]
 Aminotransferase (transaminase)
  Class IV
   Metin_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
939190..940047
Genome map
AA seq 285 aa AA seqDB search
MKIYLNGKFVPKEEAKVSVFDHGLLYGDGVFEGIRAYDGNVFMLKEHIDRLYDSAKSICL
DIPLTKEEMIDVVLETLRVNNLKDAYIRLVVTRGEGDLGLDPRKCKEPSIICIAIPMPPL
LGEEGIRAITVSVRRPPIDVLNPAVKSLNYLNSVLAKILANYANVDEALLLDKEGYVVEG
TGDNIFVVKNGVLKTSPPYLSILKGITRDVVIKLAKEEGIEVREEPITLHDLYTADELFI
TGTAAEIVPIFEIDGRIINNKKVGEITKRLRERFKEIRTKWGIKI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatctatttaaatggaaaatttgttcccaaggaagaggctaaggtttcagttttt
gaccatggtttactctatggagatggagtttttgagggaataagggcttatgatggaaat
gtgttcatgctgaaagagcatattgataggttatatgactcagcaaaatccatctgttta
gatattcctctcacaaaggaggaaatgatagatgtggttttagaaacacttagggttaac
aatttaaaagatgcttatataaggcttgtagttacaagaggggaaggagacttaggctta
gacccaaggaagtgtaaggagccaagtattatatgtatagccatccctatgcctcctctc
ttgggagaggaagggattagggctataaccgtctctgtaagaaggcctccaatagatgtt
ttaaatccagctgttaaatctctaaattacttaaatagtgtcttagccaaaattttggct
aactatgcaaatgttgatgaagctctccttttagataaagagggttatgttgttgagggt
actggagacaatatctttgttgtcaaaaatggggttttaaaaacttctccaccatactta
agtatattgaaggggataacaagagatgttgttataaagttggctaaagaggaaggaata
gaggttagggaagagccaataactttacatgatctatatactgctgatgaactctttatc
actggaacagctgctgagatagttccaatctttgaaatagatggaagaattataaataat
aaaaaagttggagagataacaaagaggttaagggagagatttaaagagattagaaccaaa
tggggaataaaaatataa

DBGET integrated database retrieval system