KEGG   Methanocaldococcus infernus: Metin_1041Help
Entry
Metin_1041        CDS       T01234                                 

Definition
(GenBank) branched-chain amino acid aminotransferase (EC:2.6.1.42)
  KO
K00826  
branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
mif  Methanocaldococcus infernus
Pathway
Cysteine and methionine metabolism
Valine, leucine and isoleucine degradation
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Metin_1041
   01230 Biosynthesis of amino acids
    Metin_1041
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Metin_1041
   00280 Valine, leucine and isoleucine degradation
    Metin_1041
   00290 Valine, leucine and isoleucine biosynthesis
    Metin_1041
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Metin_1041
Enzymes [BR:mif01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     Metin_1041
Amino acid related enzymes [BR:mif01007]
 Aminotransferase (transaminase)
  Class IV
   Metin_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
939190..940047
Genome map
AA seq 285 aa AA seqDB search
MKIYLNGKFVPKEEAKVSVFDHGLLYGDGVFEGIRAYDGNVFMLKEHIDRLYDSAKSICL
DIPLTKEEMIDVVLETLRVNNLKDAYIRLVVTRGEGDLGLDPRKCKEPSIICIAIPMPPL
LGEEGIRAITVSVRRPPIDVLNPAVKSLNYLNSVLAKILANYANVDEALLLDKEGYVVEG
TGDNIFVVKNGVLKTSPPYLSILKGITRDVVIKLAKEEGIEVREEPITLHDLYTADELFI
TGTAAEIVPIFEIDGRIINNKKVGEITKRLRERFKEIRTKWGIKI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatctatttaaatggaaaatttgttcccaaggaagaggctaaggtttcagttttt
gaccatggtttactctatggagatggagtttttgagggaataagggcttatgatggaaat
gtgttcatgctgaaagagcatattgataggttatatgactcagcaaaatccatctgttta
gatattcctctcacaaaggaggaaatgatagatgtggttttagaaacacttagggttaac
aatttaaaagatgcttatataaggcttgtagttacaagaggggaaggagacttaggctta
gacccaaggaagtgtaaggagccaagtattatatgtatagccatccctatgcctcctctc
ttgggagaggaagggattagggctataaccgtctctgtaagaaggcctccaatagatgtt
ttaaatccagctgttaaatctctaaattacttaaatagtgtcttagccaaaattttggct
aactatgcaaatgttgatgaagctctccttttagataaagagggttatgttgttgagggt
actggagacaatatctttgttgtcaaaaatggggttttaaaaacttctccaccatactta
agtatattgaaggggataacaagagatgttgttataaagttggctaaagaggaaggaata
gaggttagggaagagccaataactttacatgatctatatactgctgatgaactctttatc
actggaacagctgctgagatagttccaatctttgaaatagatggaagaattataaataat
aaaaaagttggagagataacaaagaggttaagggagagatttaaagagattagaaccaaa
tggggaataaaaatataa

DBGET integrated database retrieval system