KEGG   Methanocaldococcus infernus: Metin_1041Help
Entry
Metin_1041        CDS       T01234                                 

Definition
branched-chain amino acid aminotransferase (EC:2.6.1.42)
Orthology
K00826  
branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
mif  Methanocaldococcus infernus
Pathway
Valine, leucine and isoleucine degradation
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:mif01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mif01230]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:mif00280]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:mif00290]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:mif00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
939190..940047
Genome map
AA seq 285 aa AA seqDB search
MKIYLNGKFVPKEEAKVSVFDHGLLYGDGVFEGIRAYDGNVFMLKEHIDRLYDSAKSICL
DIPLTKEEMIDVVLETLRVNNLKDAYIRLVVTRGEGDLGLDPRKCKEPSIICIAIPMPPL
LGEEGIRAITVSVRRPPIDVLNPAVKSLNYLNSVLAKILANYANVDEALLLDKEGYVVEG
TGDNIFVVKNGVLKTSPPYLSILKGITRDVVIKLAKEEGIEVREEPITLHDLYTADELFI
TGTAAEIVPIFEIDGRIINNKKVGEITKRLRERFKEIRTKWGIKI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatctatttaaatggaaaatttgttcccaaggaagaggctaaggtttcagttttt
gaccatggtttactctatggagatggagtttttgagggaataagggcttatgatggaaat
gtgttcatgctgaaagagcatattgataggttatatgactcagcaaaatccatctgttta
gatattcctctcacaaaggaggaaatgatagatgtggttttagaaacacttagggttaac
aatttaaaagatgcttatataaggcttgtagttacaagaggggaaggagacttaggctta
gacccaaggaagtgtaaggagccaagtattatatgtatagccatccctatgcctcctctc
ttgggagaggaagggattagggctataaccgtctctgtaagaaggcctccaatagatgtt
ttaaatccagctgttaaatctctaaattacttaaatagtgtcttagccaaaattttggct
aactatgcaaatgttgatgaagctctccttttagataaagagggttatgttgttgagggt
actggagacaatatctttgttgtcaaaaatggggttttaaaaacttctccaccatactta
agtatattgaaggggataacaagagatgttgttataaagttggctaaagaggaaggaata
gaggttagggaagagccaataactttacatgatctatatactgctgatgaactctttatc
actggaacagctgctgagatagttccaatctttgaaatagatggaagaattataaataat
aaaaaagttggagagataacaaagaggttaagggagagatttaaagagattagaaccaaa
tggggaataaaaatataa

DBGET integrated database retrieval system