KEGG   Methanocaldococcus infernus: Metin_1095Help
Entry
Metin_1095        CDS       T01234                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mif  Methanocaldococcus infernus
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Metin_1095
Enzymes [BR:mif01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Metin_1095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
989227..990075
Genome map
AA seq 282 aa AA seqDB search
MFIDFSKFMLSKDYESSNIAIVSIPYDETSSFKPGSREGGLSIRRVSWGLESYSPELERD
LNDINFCDLGDLDLYGSQEEKFKMIKEAVKSILSDGKKVISLGGEHSITYPIVEAYKEFY
KDLVVIQFDAHCDLRDEYLGNPLSHACVMRRIYEINKEIMQFGIRSGDKEEWIFAKKHNI
YLKRRLLSEEDIKYIKELNKPIYLTIDIDVLDPAYAPGTGTPEPCGFSSRELFNSLYMLK
EVSDKIVGFDVVEVSPPNDVNDITSITAAKIVRELLLMIGIE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgttcatagacttttctaagtttatgctgtctaaagattatgaaagttctaacatagct
atagtttcaattccctatgatgaaacctcttcctttaagccagggtcaagggaagggggg
ttaagtataagaagagtttcttggggattggaaagttatagcccagaattggagagagat
ttaaatgatataaatttttgtgatctgggggatcttgacttatatggctctcaggaagag
aaatttaagatgataaaagaggctgtaaaaagtatcttaagtgatgggaaaaaggttatt
tctttaggtggagagcactctataacctatcctatagtagaggcttataaagaattttat
aaagacttggttgttattcaatttgatgctcactgtgatctaagagatgagtacttagga
aatcccttatctcatgcctgtgtcatgaggagaatttatgagatcaataaagagataatg
caatttggcataaggagtggagataaagaggagtggatctttgccaaaaaacataatatt
tatctaaaaagaagacttttgagtgaagaagatattaaatatataaaagaactaaataaa
ccaatctatttaactatagatatagatgtccttgatccagcctatgcacctggaactgga
actccagagccttgtggcttttcaagtagagagctttttaactctctttacatgttaaaa
gaggttagtgataaaatagttggatttgatgttgttgaagtttctcctcccaatgatgta
aatgacataacctcaataactgctgctaagattgtgagagaactcttattaatgattggg
attgagtga

DBGET integrated database retrieval system