KEGG   Methanocaldococcus infernus: Metin_1124Help
Entry
Metin_1124        CDS       T01234                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mif  Methanocaldococcus infernus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metin_1124
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metin_1124
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metin_1124
Enzymes [BR:mif01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metin_1124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1012745..1013941
Genome map
AA seq 398 aa AA seqDB search
MYKDRYPDENGKFGIYGGKFVPETLMPAIEELEKAFNKFWIKNEGNFREEFYSLLKEYVG
RPTPLYYAENLSKELGCKVYLKREDLAHLGAHKINNALGQALLAKKMGKKRVIAETGAGQ
HGVATAAACAKLGLKCEIYMGAKDVERQKLNVFRMELMGAKVIPVYGGSQTLKDAVNEAL
RDWTTNVRTTYYLLGSALGPHPYPMMVREFQRVIGKELKEQILKREGRLPNAIVACVGGG
SNAIGCFYEFLDDDVELYAVEAGGEGINKRHGASLCAGEVGVLHGSKIYVIEDEYGQIKE
SYSISAGLDYPGVGPELSFLKDEGRIKPVYVTDEEALEAFQLLCRLEGILPALESSHAIA
YAVKLAESLDKDDILVINLSGRGDKDVQTVAKALGREL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagacagatatccagatgaaaatgggaaatttgggatatatggaggaaagttt
gttcctgaaactttaatgccagctatagaagagcttgaaaaagcctttaataaattttgg
ataaagaatgagggtaactttagagaagaattttacagcttacttaaggaatatgtagga
aggcctactcctctatattatgctgaaaacctctctaaggagcttggatgtaaagtttat
ttaaagagggaagatttagcccacttaggagcacataaaataaacaatgccttgggacag
gctttattagctaagaagatgggtaaaaagagagttatagctgaaactggagctggacag
catggagtagctacagctgcagcctgtgcaaaacttgggctgaagtgtgagatttacatg
ggagctaaggatgtggagaggcaaaaattgaatgtttttagaatggaactgatgggagct
aaggttattcctgtttatggtggctctcaaactttaaaagatgctgtaaatgaagcttta
agggattggactacaaatgttaggacaacctactatctattaggctcagctcttgggcca
catccttatcctatgatggttagggaatttcagagagttataggaaaggagctgaaggaa
cagatattaaagagagagggaaggcttcctaatgcaatagttgcctgtgttggtggaggt
agtaatgccataggctgtttttatgaattcttagatgatgatgttgaactctatgctgtt
gaagctggaggagagggaataaataagagacatggagcctctctctgtgctggagaggtt
ggagttttacatggctctaagatttatgtgatagaagatgagtatggacaaataaaagag
agctatagtatctctgcaggtttagactaccctggagttgggccagaactttctttctta
aaggatgaaggtagaataaagcctgtctatgttactgatgaagaggcattagaagctttc
caattgttatgcagattagagggaatacttccagctttagaaagttctcatgccattgcc
tatgctgtaaagttggctgagagcttagataaagatgatatcttagttatcaacctttca
ggtagaggagataaggatgtccaaacagtggctaaggcattgggaagggaactatga

DBGET integrated database retrieval system