KEGG   Methanocaldococcus infernus: Metin_1128Help
Entry
Metin_1128        CDS       T01234                                 

Definition
4Fe-4S ferredoxin iron-sulfur binding domain protein
Orthology
K00204  
4Fe-4S ferredoxin
Organism
mif  Methanocaldococcus infernus
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metin_1128
  Energy metabolism
   00680 Methane metabolism
    Metin_1128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1016511..1016963
Genome map
AA seq 150 aa AA seqDB search
MPEHILSGIKAIVAKKLKEKGYLQREIAKKIKVDRSMVSHYLHGRFPKKKVIEFVKIIEE
LPPSCGSKLIHSIANDKELAKELVKELYNPKLVWDRDKCLFCGSCLVCEALTLEGETLNI
NFEKCYLCGECTFICPTKALTLKRDSNDKS
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgccagagcatatcttatctggaattaaggcaatagttgctaagaagttaaaagagaag
ggctatttacagagggagattgctaagaagataaaggttgataggagtatggtttcccac
tatctacatggaagatttcctaagaaaaaagttatagagtttgtaaaaattattgaggag
ttgccaccaagctgtggctccaagttgatacattcaatagccaatgataaagagttagct
aaggaattggttaaagagctatataaccctaagcttgtatgggatagggataagtgccta
ttctgtggctcctgccttgtgtgtgaggcactcacattagaaggagaaactttaaatata
aattttgaaaaatgttacttgtgtggagaatgcacatttatatgtccaacaaaggcacta
acacttaagagggatagtaatgataaaagctga

DBGET integrated database retrieval system