KEGG   Methanocaldococcus infernus: Metin_1128Help
Entry
Metin_1128        CDS       T01234                                 

Definition
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain protein
  KO
K00204  4Fe-4S ferredoxin
Organism
mif  Methanocaldococcus infernus
Pathway
mif00680  Methane metabolism
mif01100  Metabolic pathways
mif01120  Microbial metabolism in diverse environments
mif01200  Carbon metabolism
Module
mif_M00567  Methanogenesis, CO2 => methane
mif_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Metin_1128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 HTH_3 Fer4_10 Fer4_6 Fer4_2 HTH_19 Fer4_9 Fer4_16 Fer4_21 HTH_23 HTH_38 HTH_37 RepB Fer4_22 Fer4_17 YdaS_antitoxin Bse634I DUF3562 Fer4_8
Motif
Other DBs
NCBI-ProteinID: ADG13782
JGI: Metin_1128
UniProt: D5VT79
Position
1016511..1016963
Genome map
AA seq 150 aa AA seqDB search
MPEHILSGIKAIVAKKLKEKGYLQREIAKKIKVDRSMVSHYLHGRFPKKKVIEFVKIIEE
LPPSCGSKLIHSIANDKELAKELVKELYNPKLVWDRDKCLFCGSCLVCEALTLEGETLNI
NFEKCYLCGECTFICPTKALTLKRDSNDKS
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgccagagcatatcttatctggaattaaggcaatagttgctaagaagttaaaagagaag
ggctatttacagagggagattgctaagaagataaaggttgataggagtatggtttcccac
tatctacatggaagatttcctaagaaaaaagttatagagtttgtaaaaattattgaggag
ttgccaccaagctgtggctccaagttgatacattcaatagccaatgataaagagttagct
aaggaattggttaaagagctatataaccctaagcttgtatgggatagggataagtgccta
ttctgtggctcctgccttgtgtgtgaggcactcacattagaaggagaaactttaaatata
aattttgaaaaatgttacttgtgtggagaatgcacatttatatgtccaacaaaggcacta
acacttaagagggatagtaatgataaaagctga

DBGET integrated database retrieval system