KEGG   Methanocaldococcus infernus: Metin_1255Help
Entry
Metin_1255        CDS       T01234                                 

Definition
dTDP-4-dehydrorhamnose 35-epimerase related protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mif  Methanocaldococcus infernus
Pathway
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Metin_1255
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Metin_1255
Enzymes [BR:mif01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Metin_1255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1131198..1131317
Genome map
AA seq 39 aa AA seqDB search
MPFEFVRLEIPGVILIKPKVFGDERGFFMETYKKSDFKV
NT seq 120 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgagtttgtgaggttagagattccaggggttatattaataaagccaaaggtg
tttggagatgaaagaggattttttatggaaacttataagaaatctgactttaaagtataa

DBGET integrated database retrieval system