KEGG   Methanocaldococcus infernus: Metin_1270Help
Entry
Metin_1270        CDS       T01234                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mif  Methanocaldococcus infernus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metin_1270
   01230 Biosynthesis of amino acids
    Metin_1270
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metin_1270
   00051 Fructose and mannose metabolism
    Metin_1270
   00562 Inositol phosphate metabolism
    Metin_1270
Enzymes [BR:mif01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Metin_1270
Exosome [BR:mif04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Metin_1270
  Exosomal proteins of bladder cancer cells
   Metin_1270
  Exosomal proteins of melanoma cells
   Metin_1270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1146494..1147147
Genome map
AA seq 217 aa AA seqDB search
MIIIINYKTYKEGLGERGKEIAEIAKKVSEESGVEIAVAPQYVDLREIAKITKCYAQHVD
NIKPGSFTGHILPESIKDAGAVGTLINHSERRLLLSDIEEIIKRCRELSLETVVCTNNIN
TSRAVATLKPDYIAVEPPELIGTGIPVSKANPEIVEGTVRAVKEIDKDIKVLCGAGISKG
EDVKAALELGAEGVLLASGVVKAKDPEAVIRDLIKYI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
ttgataataatcattaactacaaaacctataaagaaggtttaggagagagagggaaagag
atagctgagatagctaagaaagtttctgaagagagtggggtggagatagctgtagctcct
cagtatgttgatctaagggagatagctaagataaccaaatgttatgctcaacatgttgat
aacataaaaccaggaagttttacaggccatattttgccagagagtataaaagatgctgga
gctgttggaacattgataaatcactctgagagaagattactattatcagatatagaggaa
ataataaagagatgtagggagttaagcttagaaacagtggtttgtaccaacaatataaat
acttcaagggctgtagccactttaaagccagactatatagctgttgaacctcctgagttg
ataggaacaggaattccagtttctaaggcaaatcctgagattgttgaaggaacagttaga
gctgtcaaggaaattgataaagatattaaagttctctgtggggcaggaatatctaaggga
gaggatgttaaagctgccttagagcttggagctgaaggagttttattagcttcaggggtg
gttaaggctaaggatcctgaggctgtgataagagacttaataaaatatatttaa

DBGET integrated database retrieval system