KEGG   Methanocaldococcus infernus: Metin_1270Help
Entry
Metin_1270        CDS       T01234                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mif  Methanocaldococcus infernus
Pathway
mif00010  Glycolysis / Gluconeogenesis
mif00051  Fructose and mannose metabolism
mif00562  Inositol phosphate metabolism
mif01100  Metabolic pathways
mif01110  Biosynthesis of secondary metabolites
mif01120  Microbial metabolism in diverse environments
mif01130  Biosynthesis of antibiotics
mif01200  Carbon metabolism
mif01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metin_1270
   00051 Fructose and mannose metabolism
    Metin_1270
   00562 Inositol phosphate metabolism
    Metin_1270
Enzymes [BR:mif01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Metin_1270
Exosome [BR:mif04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Metin_1270
  Exosomal proteins of bladder cancer cells
   Metin_1270
  Exosomal proteins of melanoma cells
   Metin_1270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG NMO FMN_dh His_biosynth IGPS DHO_dh Lipoprotein_1 Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ADG13920
JGI: Metin_1270
UniProt: D5VTL7
Position
1146494..1147147
Genome map
AA seq 217 aa AA seqDB search
MIIIINYKTYKEGLGERGKEIAEIAKKVSEESGVEIAVAPQYVDLREIAKITKCYAQHVD
NIKPGSFTGHILPESIKDAGAVGTLINHSERRLLLSDIEEIIKRCRELSLETVVCTNNIN
TSRAVATLKPDYIAVEPPELIGTGIPVSKANPEIVEGTVRAVKEIDKDIKVLCGAGISKG
EDVKAALELGAEGVLLASGVVKAKDPEAVIRDLIKYI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
ttgataataatcattaactacaaaacctataaagaaggtttaggagagagagggaaagag
atagctgagatagctaagaaagtttctgaagagagtggggtggagatagctgtagctcct
cagtatgttgatctaagggagatagctaagataaccaaatgttatgctcaacatgttgat
aacataaaaccaggaagttttacaggccatattttgccagagagtataaaagatgctgga
gctgttggaacattgataaatcactctgagagaagattactattatcagatatagaggaa
ataataaagagatgtagggagttaagcttagaaacagtggtttgtaccaacaatataaat
acttcaagggctgtagccactttaaagccagactatatagctgttgaacctcctgagttg
ataggaacaggaattccagtttctaaggcaaatcctgagattgttgaaggaacagttaga
gctgtcaaggaaattgataaagatattaaagttctctgtggggcaggaatatctaaggga
gaggatgttaaagctgccttagagcttggagctgaaggagttttattagcttcaggggtg
gttaaggctaaggatcctgaggctgtgataagagacttaataaaatatatttaa

DBGET integrated database retrieval system