KEGG   Methanocaldococcus infernus: Metin_1270Help
Entry
Metin_1270        CDS       T01234                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mif  Methanocaldococcus infernus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metin_1270
   01230 Biosynthesis of amino acids
    Metin_1270
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metin_1270
   00051 Fructose and mannose metabolism
    Metin_1270
   00562 Inositol phosphate metabolism
    Metin_1270
Enzymes [BR:mif01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Metin_1270
Exosome [BR:mif04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Metin_1270
  Exosomal proteins of bladder cancer cells
   Metin_1270
  Exosomal proteins of melanoma cells
   Metin_1270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1146494..1147147
Genome map
AA seq 217 aa AA seqDB search
MIIIINYKTYKEGLGERGKEIAEIAKKVSEESGVEIAVAPQYVDLREIAKITKCYAQHVD
NIKPGSFTGHILPESIKDAGAVGTLINHSERRLLLSDIEEIIKRCRELSLETVVCTNNIN
TSRAVATLKPDYIAVEPPELIGTGIPVSKANPEIVEGTVRAVKEIDKDIKVLCGAGISKG
EDVKAALELGAEGVLLASGVVKAKDPEAVIRDLIKYI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
ttgataataatcattaactacaaaacctataaagaaggtttaggagagagagggaaagag
atagctgagatagctaagaaagtttctgaagagagtggggtggagatagctgtagctcct
cagtatgttgatctaagggagatagctaagataaccaaatgttatgctcaacatgttgat
aacataaaaccaggaagttttacaggccatattttgccagagagtataaaagatgctgga
gctgttggaacattgataaatcactctgagagaagattactattatcagatatagaggaa
ataataaagagatgtagggagttaagcttagaaacagtggtttgtaccaacaatataaat
acttcaagggctgtagccactttaaagccagactatatagctgttgaacctcctgagttg
ataggaacaggaattccagtttctaaggcaaatcctgagattgttgaaggaacagttaga
gctgtcaaggaaattgataaagatattaaagttctctgtggggcaggaatatctaaggga
gaggatgttaaagctgccttagagcttggagctgaaggagttttattagcttcaggggtg
gttaaggctaaggatcctgaggctgtgataagagacttaataaaatatatttaa

DBGET integrated database retrieval system