KEGG   Methanocaldococcus infernus: Metin_1337Help
Entry
Metin_1337        CDS       T01234                                 

Definition
pyruvate/ketoisovalerate oxidoreductase, gamma subunit
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mif  Methanocaldococcus infernus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metin_1337
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metin_1337
   00020 Citrate cycle (TCA cycle)
    Metin_1337
   00620 Pyruvate metabolism
    Metin_1337
   00640 Propanoate metabolism
    Metin_1337
   00650 Butanoate metabolism
    Metin_1337
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metin_1337
   00680 Methane metabolism
    Metin_1337
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metin_1337
Enzymes [BR:mif01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metin_1337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1200506..1201042
Genome map
AA seq 178 aa AA seqDB search
MIEIRFHGRGGQGAVTAAQILAKAAFYDGKYCQAFPFFGVERRGAPVRAFTRIDDKEILI
RSQIYEPDYVVVLDPTLLDSVNVLEGLKKDGAVIVNTVKDLDLGYKVYTLDATKIALDVL
GVPIVNTSMVGAFAGATKLVSLESVKKAILETFKGKLGEKNALAAEKAYNEIIEKYGE
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaaattagattccatgggagaggagggcaaggggctgttactgcagcccaaatt
ttggctaaagctgccttttatgatggaaagtattgccaggcatttcctttttttggtgtt
gagaggagaggtgcaccagttagagctttcacaagaattgatgataaagaaattttgata
agatctcaaatctatgagcctgattatgttgttgtcttagatccaactcttttagattct
gtaaatgtcttagaggggttaaagaaggatggagctgtaattgttaacactgttaaagac
ttagatttaggatataaagtttatacacttgacgcaacaaagatagccttagatgtttta
ggagttcctattgttaatacatcaatggttggagcctttgctggagcaactaagttggtt
agcttagaatctgtaaagaaagctattttagagacatttaaagggaagttgggagagaag
aatgccttagctgctgagaaggcatacaatgagatcatagagaagtatggtgagtaa

DBGET integrated database retrieval system