KEGG   Methanocaldococcus infernus: Metin_1338Help
Entry
Metin_1338        CDS       T01234                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mif  Methanocaldococcus infernus
Pathway
mif00010  Glycolysis / Gluconeogenesis
mif00020  Citrate cycle (TCA cycle)
mif00620  Pyruvate metabolism
mif00633  Nitrotoluene degradation
mif00640  Propanoate metabolism
mif00650  Butanoate metabolism
mif00680  Methane metabolism
mif00720  Carbon fixation pathways in prokaryotes
mif01100  Metabolic pathways
mif01120  Microbial metabolism in diverse environments
mif01130  Biosynthesis of antibiotics
mif01200  Carbon metabolism
Module
mif_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mif_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metin_1338
   00020 Citrate cycle (TCA cycle)
    Metin_1338
   00620 Pyruvate metabolism
    Metin_1338
   00640 Propanoate metabolism
    Metin_1338
   00650 Butanoate metabolism
    Metin_1338
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metin_1338
   00680 Methane metabolism
    Metin_1338
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metin_1338
Enzymes [BR:mif01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metin_1338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_10 Fer4_9 Fer4_16 Fer4_2 Fer4_7 Fer4_17 Fer4_8 Fer4_4 Fer4_13
Motif
Other DBs
NCBI-ProteinID: ADG13988
JGI: Metin_1338
UniProt: D5VTT5
Position
1201045..1201302
Genome map
AA seq 85 aa AA seqDB search
MVNIGAIIYEPGSSVKNKTGTWRVFKPILNVELCVKCENCYIFCPEPAIYEEDGVFKINY
DYCKGCLICANECPTGAITKTREEK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggttaatattggagccattatctatgaaccaggaagctcagttaagaacaaaacagga
acttggagagtatttaaacctattttgaatgttgagctctgtgttaaatgtgaaaattgc
tatatcttctgcccagagcctgctatttatgaggaagatggagtttttaaaataaattat
gactactgtaaaggctgcttaatctgtgccaatgagtgtccaactggagctataacaaag
acaagggaagaaaaataa

DBGET integrated database retrieval system