KEGG   Methanocaldococcus infernus: Metin_1339Help
Entry
Metin_1339        CDS       T01234                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mif  Methanocaldococcus infernus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metin_1339
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metin_1339
   00020 Citrate cycle (TCA cycle)
    Metin_1339
   00620 Pyruvate metabolism
    Metin_1339
   00640 Propanoate metabolism
    Metin_1339
   00650 Butanoate metabolism
    Metin_1339
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metin_1339
   00680 Methane metabolism
    Metin_1339
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metin_1339
Enzymes [BR:mif01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metin_1339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1201322..1202455
Genome map
AA seq 377 aa AA seqDB search
MKKVITGTSAAAEAVRLCDVDVVAAYPITPQTSCVEKIAEFVANGELDAEYIKVESEHSA
MAACIGASATGARTFTATASQGLALMHELLFIASGMRLPIVMLNTNRALSAPINIWCDHQ
DSISQRDTGWIQLYAENNQETLDLVIQAYKIAETVLLPVMVNIDGFILTHTVEPVEIPEE
EKVRNFVGVYEPRHAYLDPDRPITQGPVGVPECYMETRKQIEEAMEEAKKVIDKVNKEFE
KEFGRKYSLIETYNLENADTVLMAMGSVCGTIKHYINNYDNKVGLIKVRTYRPFPKEEIR
KVLEDFDKVGILDKNISFGMNMGALAIDCLTILKDKTICNYIVGLGGRDITIQNIKEIVE
NLRRAKKDKTEWIGLNK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggttataactggaacttcagcagctgctgaagctgttaggttgtgtgacgtt
gacgttgttgcagcttatccaatcactccacaaacaagctgtgttgaaaagatagctgaa
tttgtggctaatggagagttggatgctgaatatataaaggttgagagtgagcactcagca
atggctgcctgtataggagcaagtgctacaggagcaagaacctttactgctacagcttct
caaggattagctttaatgcatgaacttctcttcatagcttcagggatgagattaccaata
gttatgctaaacacaaatagagcattatcagctccaataaatatatggtgtgatcatcaa
gattctatatcccaaagagacactggttggatacaactttatgctgagaacaaccaggaa
actttagatttggttatacaagcttataagatagctgaaactgtcttacttccagtgatg
gttaatattgatgggtttatcttaacccatacagttgagcctgttgagattccagaggaa
gagaaggttagaaactttgttggagtttatgagccaaggcatgcatacttagatccagat
aggccaataacccaaggacctgtaggagtgccagagtgttacatggaaacaagaaaacag
atagaggaagctatggaagaggctaagaaagttattgataaggttaataaagagtttgaa
aaagagtttggcagaaagtatagtttaattgaaacttataacttggagaatgctgacact
gtcttaatggctatgggatcagtttgtggaaccattaaacactacatcaataactatgac
aataaggttggtctcataaaggttagaacatatagacccttcccaaaagaggagataagg
aaagttttagaagattttgataaggttggaatcttagataaaaatataagctttggaatg
aacatgggagctttagctatagattgcttaactatacttaaggataaaactatctgtaat
tatatagttgggcttggaggaagggatataacaattcagaatattaaggagattgttgaa
aacttaagaagagctaaaaaagataaaactgagtggataggactaaataaataa

DBGET integrated database retrieval system