KEGG   Methanocaldococcus infernus: Metin_1340Help
Entry
Metin_1340        CDS       T01234                                 

Definition
thiamine pyrophosphate protein domain protein TPP-binding protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mif  Methanocaldococcus infernus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metin_1340
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metin_1340
   00020 Citrate cycle (TCA cycle)
    Metin_1340
   00620 Pyruvate metabolism
    Metin_1340
   00640 Propanoate metabolism
    Metin_1340
   00650 Butanoate metabolism
    Metin_1340
  Energy metabolism
   00680 Methane metabolism
    Metin_1340
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metin_1340
Enzymes [BR:mif01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metin_1340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1202471..1203358
Genome map
AA seq 295 aa AA seqDB search
MQFPREEFLAPGHRGCAGCGASIVVRLALKAAGKDTIVTTPTGCLEVMTTPYPETAWKVP
WIHVAFECAGAVASGISRAVKALKRKRGKFKDKKINVIAIGGDGGSADIGFQSLSGAMER
GEDILYIMYDNEAYMNTGIQRSSETPLFAATTTSPAGKVWKGEDKPKKDMPMIMAAHGVP
YVATACISYPEDFMRKVKKALSIEGPKFIHVLQPCTTGWGYPPDKTIEIGRLAVETGVFP
LYEIEYGEFRLTYKPAKRKPVKEYIRMQKRFRHLTDEDIEKIQKYIDERCKLLGL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttccaagggaagagtttttagctcctggacatagaggatgtgctggctgtgga
gcttctatagttgttagactggcattaaaagctgctggaaaagatactatagttacaact
ccaactggctgtttagaggttatgacaaccccttacccagaaacagcttggaaggttccc
tggatccatgtggcctttgaatgtgctggagctgtggcaagtgggataagtagggctgta
aaagctttaaagagaaagagagggaaatttaaagataaaaagataaatgttatagctatt
gggggagatggaggatcagcagatataggatttcaatccctaagtggagctatggaaaga
ggggaagatattctctatattatgtatgataatgaagcttacatgaacacaggaattcag
agaagttcagaaactccactatttgctgcaacaacaacctctccagcagggaaggtttgg
aaaggagaggataagccaaagaaagacatgcccatgatcatggctgcccatggggttcct
tatgttgcaacagcctgtataagctatcctgaagacttcatgagaaaggttaaaaaagct
ctctcaattgaggggcctaaatttattcatgtgttacagccatgtaccacaggttggggc
tacccaccagataaaactatagaaattggtaggttagctgtagaaactggagttttccca
ttgtatgaaatagagtatggagaatttagattaacttacaagccagccaagagaaagcca
gttaaggaatatataagaatgcagaagaggtttagacacttaacagatgaagacattgaa
aaaattcagaagtatatagatgagagatgtaagcttttaggcttgtaa

DBGET integrated database retrieval system