KEGG   Methanocaldococcus infernus: Metin_1340Help
Entry
Metin_1340        CDS       T01234                                 

Definition
thiamine pyrophosphate protein domain protein TPP-binding protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mif  Methanocaldococcus infernus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metin_1340
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metin_1340
   00020 Citrate cycle (TCA cycle)
    Metin_1340
   00620 Pyruvate metabolism
    Metin_1340
   00640 Propanoate metabolism
    Metin_1340
   00650 Butanoate metabolism
    Metin_1340
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metin_1340
   00680 Methane metabolism
    Metin_1340
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metin_1340
Enzymes [BR:mif01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metin_1340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1202471..1203358
Genome map
AA seq 295 aa AA seqDB search
MQFPREEFLAPGHRGCAGCGASIVVRLALKAAGKDTIVTTPTGCLEVMTTPYPETAWKVP
WIHVAFECAGAVASGISRAVKALKRKRGKFKDKKINVIAIGGDGGSADIGFQSLSGAMER
GEDILYIMYDNEAYMNTGIQRSSETPLFAATTTSPAGKVWKGEDKPKKDMPMIMAAHGVP
YVATACISYPEDFMRKVKKALSIEGPKFIHVLQPCTTGWGYPPDKTIEIGRLAVETGVFP
LYEIEYGEFRLTYKPAKRKPVKEYIRMQKRFRHLTDEDIEKIQKYIDERCKLLGL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttccaagggaagagtttttagctcctggacatagaggatgtgctggctgtgga
gcttctatagttgttagactggcattaaaagctgctggaaaagatactatagttacaact
ccaactggctgtttagaggttatgacaaccccttacccagaaacagcttggaaggttccc
tggatccatgtggcctttgaatgtgctggagctgtggcaagtgggataagtagggctgta
aaagctttaaagagaaagagagggaaatttaaagataaaaagataaatgttatagctatt
gggggagatggaggatcagcagatataggatttcaatccctaagtggagctatggaaaga
ggggaagatattctctatattatgtatgataatgaagcttacatgaacacaggaattcag
agaagttcagaaactccactatttgctgcaacaacaacctctccagcagggaaggtttgg
aaaggagaggataagccaaagaaagacatgcccatgatcatggctgcccatggggttcct
tatgttgcaacagcctgtataagctatcctgaagacttcatgagaaaggttaaaaaagct
ctctcaattgaggggcctaaatttattcatgtgttacagccatgtaccacaggttggggc
tacccaccagataaaactatagaaattggtaggttagctgtagaaactggagttttccca
ttgtatgaaatagagtatggagaatttagattaacttacaagccagccaagagaaagcca
gttaaggaatatataagaatgcagaagaggtttagacacttaacagatgaagacattgaa
aaaattcagaagtatatagatgagagatgtaagcttttaggcttgtaa

DBGET integrated database retrieval system