KEGG   Methanocaldococcus infernus: Metin_1460Help
Entry
Metin_1460        CDS       T01234                                 

Definition
asparagine synthase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mif  Methanocaldococcus infernus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mif00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1316258..1318147
Genome map
AA seq 629 aa AA seqDB search
MCGINGIIRFNGKVEKEEILKMNKAIKHRGPDDEGAFVSNNIGLGHVRLAILDLSEKGHQ
PMGLTKEGKIIYKDDELEKADYIIVYNGEVYNYKELIEKFNLKTETGTDTEIILRLYQKL
GFDCVKEFNGMWAFAIYDKEKNILFCSRDRLGVKPFYYYWDGEEFIFSSELKGILAVKKL
NKKENINKEAVQLYFALGFIPSPWTIYNKTFKLEAAHNLVLDLAKREIKKWRYWELPKYN
PIYDKKKLIEEGKKLLEDAVRIRMRSDVPVGAFLSGGLDSSTVVAVMSKFTDLKKLHTFS
IGFEGKYDETPYIKTVVDHLKTQHHHYYFKEKDFEELIDKYVWIYDEPFGDYSGFPTYKV
SELAKKYVTVCLSGDGGDEVFAGYMNHLAARRYELIKRIPKILRKALYLILSKLNKQKKL
NSFFSLTTLTEALRLSLMADFKFYSEAFESERISPKVFKNWSENNLKYSLRVSNNCFAEA
IRVYDLLFNTLSDHFLVKVDRASMANALEVRSPFLDYRFAEFSQKIPIEWKVNLFKTKKL
MREIIENYLPKEIVNRGKWGFTPPLEEWILKEKYLKEIENNLKVLKEIDKELYNFFKEKV
LKNKDQKIYKIYLIRLFIFIKWWERWTKN
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtataaatggaataattagatttaatggaaaagttgagaaagaagaaatttta
aagatgaataaagccattaaacatagagggcctgatgatgaaggagcttttgttagtaat
aacattggcttaggacatgttagattagctattcttgatttatctgagaaagggcatcag
ccaatgggtttaactaaggaagggaagataatttataaagatgatgagttagagaaagca
gattatattattgtttataatggagaggtttataactataaggagttaatagaaaaattt
aacctaaaaactgaaactggaactgacactgaaattattttaagactttatcaaaaactt
ggctttgattgtgttaaagagtttaatggcatgtgggcttttgctatttatgataaagag
aaaaatatcttgttttgctcaagagataggcttggagttaagcctttctattactattgg
gatggagaagagtttattttttcctctgagttaaagggaatcttagcagttaaaaagtta
aacaagaaggagaatataaataaagaggctgttcaactttactttgctcttggctttatc
ccctctccttggactatttataacaaaacttttaagttagaagcagctcacaacttagtc
ttagatttagctaaaagagaaataaaaaaatggagatattgggagttgccaaaatacaac
ccaatttatgataaaaagaaattaatagaggaagggaaaaagcttttagaagatgctgta
agaataagaatgagaagtgatgttccagttggggcttttttaagcggtggcttagatagc
tcaacagttgtagctgttatgagtaaatttactgatttaaagaagttacatactttttct
ataggctttgagggaaaatatgatgaaactccttacataaagacggttgttgatcattta
aaaactcagcatcatcattattatttcaaagagaaggattttgaagaattaattgataaa
tatgtttggatttatgatgagccttttggagactattctggctttcctacttataaagtt
agtgagcttgctaagaaatatgttactgtatgtctaagtggagatggtggagatgaagtt
tttgctggttacatgaatcatttagctgcaagaagatatgaattaatcaagagaataccc
aaaattttgaggaaagctttatatttaatattaagtaagttaaataagcaaaaaaaatta
aatagctttttcagtttgactactttaactgaagctttaagactctctttaatggcagat
tttaaattttattcagaagcctttgaaagtgaaagaatttctccaaaggtatttaaaaac
tggagtgaaaacaacttaaaatattctttaagagtttctaataattgctttgctgaagct
attagagtctatgatttgctttttaatactttatctgatcatttcttagttaaagtggat
agagcttcaatggccaatgccttagaagttagaagccctttcttagattatagatttgct
gaattttcacaaaaaattccaatagagtggaaagttaatttatttaaaactaaaaagtta
atgagagaaattattgaaaattatcttcctaaggagatagttaatagaggtaagtggggc
tttaccccaccattagaggagtggatactgaaagagaaatatttgaaggaaatagaaaat
aatttaaaagttttaaaagaaatagataaagaactttataatttttttaaagaaaaagtt
ttaaagaataaggatcagaaaatatataagatttatttgattagattatttatatttata
aagtggtgggaaagatggacaaaaaattag

DBGET integrated database retrieval system