KEGG   Methanotorris igneus: Metig_0072Help
Entry
Metig_0072        CDS       T01510                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mig  Methanotorris igneus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Metig_0072
Enzymes [BR:mig01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Metig_0072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(82784..83836)
Genome map
AA seq 350 aa AA seqDB search
MRVVEYLKKLAEEKGISGREHRVRELMKKELEPMVDEIYVDKFGNLIARKGDKGPKIMLA
AHMDEIGLMVKYIDEKGFLKFTKIGGINDQMILNQKVIVHGNKGDIIGVLGSKPPHKMKE
SERNKLIKYEDMFIDIGAESREEAIEMGVEIGTWVTFKSEFNELGKNRFTCKAFDDRVGC
AVLLEVMRRIKDEDLNCQVYAVGTVQEEVGLKGARTSAFGINPDVALALDVTICGDHPGI
KMEDAPVELGKGPVVGIVDAAGRGLITHPKVLDMIRDISKKYDIPVQYEVGEGGTTDATA
IHLTRDGIPTGVISIPARYIHTPVEVIDKRDVEKTVELVVSCIKDLDKYF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagggtagttgaatatttaaaaaagcttgcagaggaaaaaggaatttctggaagagaa
catagagtcagagagttaatgaaaaaagagcttgagccaatggttgatgaaatctacgtg
gacaaatttgggaatttaattgcgagaaagggagataaagggccaaagataatgcttgct
gcacacatggatgagattgggttaatggttaaatacattgatgaaaaaggattcttgaag
ttcacaaaaattgggggcataaatgaccagatgatcctaaaccaaaaggtcattgttcat
ggaaataagggagatattattggggttttaggttcaaaaccaccacacaaaatgaaagaa
agcgagagaaacaaacttattaaatatgaggatatgtttattgacattggggcagagagt
agggaagaggcaattgaaatgggtgttgagataggaacatgggttacattcaagtcagaa
ttcaatgagttagggaaaaacagatttacatgcaaagcatttgatgatagggtaggatgt
gcagttttattggaagttatgaggagaattaaagatgaggacttgaactgccaagtttat
gcagtaggaacagtccaggaagaagttggtttaaaaggggcaaggacatctgcctttgga
ataaatccagatgttgctttggcgttggatgttaccatctgtggagaccatccgggaata
aagatggaagatgcaccagttgaattaggaaaagggcctgttgtggggatagttgatgca
gcagggagaggattgatcactcatccaaaggtattggacatgataagagatatctccaaa
aaatatgatattccagttcaatatgaagtcggtgaaggtggaacaacagacgctacagca
atccatttaacaagggatggtatcccaactggagtaatttctatcccagcaagatacatc
cacacaccagttgaagttatcgataagagagatgtggaaaaaactgttgaattagttgtt
tcatgcataaaagatttagacaaatacttctaa

DBGET integrated database retrieval system