KEGG   Methanotorris igneus: Metig_0186Help
Entry
Metig_0186        CDS       T01510                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mig  Methanotorris igneus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mig00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
190341..191072
Genome map
AA seq 243 aa AA seqDB search
MKVVITRPRERASYFAKLLEDNGFEPILIPTLELVYKKDVKIDVDKYDWILFTSPSGVKG
LYDIIDDKEKEKVKNKKIGAIGIKTAKAFEKYFGKYPDVVPKEYTAEGLLEELRKMINGD
ERFLIPTTPSTRDVLKNNLNADLFFVYTSEEPKDIKEKVEKLKEIIKEESKKNKRIILTF
TSGLTARNFFKNADNELKELLKNQYIVAIGPVTKKEINKFGFNALTPKEYTIEGMLEVIK
NLK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtagtaataacgagaccaagggaaagggcaagttattttgctaagttattggag
gataatggttttgagccaattttaatcccaacattagagttggtttataaaaaggacgtt
aagattgacgttgacaaatatgactggattcttttcacatccccaagcggtgtaaagggg
ttgtatgatataatagatgacaaagaaaaagaaaaagtcaaaaataagaaaattggtgca
attgggattaaaactgctaaggcatttgagaagtattttggaaaatatccagatgtggtt
ccaaaagaatatactgctgaagggttattggaggaattaagaaaaatgattaatggagat
gagaggtttttaattccaacaacaccatcaacaagagatgttttgaagaataatttaaat
gcagatttgttttttgtttatacttcagaggagccaaaagatataaaggaaaaagtggaa
aagttgaaggaaataataaaagaagagagtaaaaaaaataaaaggataatcctcacattt
acaagtggcttaactgcaaggaatttctttaaaaatgcagataatgaactcaaagaacta
ttgaaaaaccaatatatcgttgcaataggtccggtaacaaagaaagaaataaataaattt
ggatttaatgccttaacaccaaaagaatacaccatcgaggggatgttagaggttattaaa
aatttaaaatga

DBGET integrated database retrieval system