KEGG   Methanotorris igneus: Metig_0235Help
Entry
Metig_0235        CDS       T01510                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mig  Methanotorris igneus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Metig_0235
Enzymes [BR:mig01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Metig_0235
Peptidases [BR:mig01002]
 Cysteine Peptidases
  Family C44
   Metig_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
240478..242352
Genome map
AA seq 624 aa AA seqDB search
MCGINGIVRFDNEILEEEIKRMNKAIKHRGPDDEGVYVNNFIGLGHVRLAILDLSEKGHQ
PMGLTKNGKIIYRDEELDKAKYIIVYNGEVYNYKELIEKFNLKTETGTDTEVILKLYQKL
GFDCVKEFNGMWAFVIYDREKNIIFASRDRLGVKPFYYYWDGEEFIFSSELKGILAVKEL
NRKENINKEAVQLYFALGFIPSPWTIYNKTFKLEAAHNLVLDLGKKEIKKWRYWELPKYN
PIYDKKKLIEEGKKLLEDAVKIRLRSDVPVGAFLSGGLDSSTVVAVMSKFTDLKKLHTFS
IGFEGKYDETPYIKIVVDYLRTQHHHYYFKEKDFEVLIDKYVWIYDEPFGDYSGFPTYKV
SEMAKKYVTVVLSGDGGDEVFGGYKFHIISRRIEYLKKIPLFIRLMFLKILNNISLKKNF
TLYLIKEAIKLSLVSNEKFYSELFDGDFIISNEGKIWIEKNLKYCLENTDNNLSESIRIF
DLLFRTLSDNFLVKVDRASMANSLEVRSPFLDYRFAEFSQKIPTEWKVDFFKTKKLMREI
IKDILPDEIVNRGKGGFEPPLADWILKEEYLNEVYKNVVILKDIDESLYNFFKEKVFKNK
ENLLYRIYLIRLFIFIKWWKRWIK
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattaatggtattgttagatttgataatgagattttagaagaagaaattaaa
aggatgaacaaagctattaaacatagaggacctgatgatgaaggagtttatgtaaataat
tttattggtttagggcatgttagattggctattcttgacttgtcagagaaagggcatcag
ccaatgggattaactaaaaatggtaaaattatttatagagatgaggagcttgataaagcc
aaatatattattgtctataatggggaggtgtataattataaagagttgatagagaagttt
aatttaaagacagagacagggactgatactgaagttatattaaagctttatcaaaaactt
ggtttcgactgtgttaaagaattcaatggcatgtgggcatttgttatttatgatagagaa
aaaaatattatttttgcttcaagggataggttaggggttaagcccttttattactattgg
gatggggaggagtttatattcagctctgaattaaaaggaattttagctgttaaagaattg
aatagaaaagagaatataaataaagaggcagttcaactttactttgctcttggttttatt
ccttctccctggactatatataataaaacttttaagttagaggctgctcacaacttagtt
ttagatttgggtaaaaaagaaataaaaaagtggagatattgggagcttcctaagtataat
ccaatttatgataaaaagaagttaatagaagagggtaaaaagcttttagaggatgctgta
aaaataagattaagatcagatgttcctgtaggggcttttttaagtggtggattagatagc
tctacagttgttgctgttatgagcaaatttactgatttgaaaaagttgcatactttttct
attggctttgaaggaaagtatgatgaaaccccttacataaaaatagttgttgattattta
agaacccaacatcaccactattattttaaagagaaagattttgaggtgctaattgataag
tatgtctggatttatgatgagccatttggagattactctggctttcctacttataaagtt
tctgagatggctaagaaatatgtaactgttgttttaagcggtgatggcggggatgaggtt
tttggaggatataaatttcatattattagtagaagaatagaatacctaaaaaagattcca
ttatttattagattaatgtttctgaaaatattaaataatatttctttaaaaaaaaatttc
acgttgtatttaattaaagaggctattaaactatctttggttagtaatgaaaaattttat
tcggaattgtttgatggagactttattatttctaatgagggcaaaatttggatagaaaaa
aatttaaagtactgtttagaaaatacagacaataacctttcagaatccattagaattttt
gatttactatttaggacgttatctgataatttcttagttaaagttgatagggcatcaatg
gccaactctttagaggttagaagtccttttttagattatcgatttgctgaatttagccag
aaaataccaacagaatggaaagtagatttttttaaaactaagaaattaatgagagaaatt
ataaaagatattttgccagatgagatagttaatagaggaaaaggaggttttgaacctcca
ttagctgattggattttgaaagaagagtatttaaatgaggtttataaaaatgttgtaata
ctgaaagatattgacgaaagtctttataattttttcaaagaaaaagtttttaaaaataaa
gaaaatttattgtataggatttatttaataagattatttatatttataaaatggtggaaa
agatggataaagtaa

DBGET integrated database retrieval system