KEGG   Methanotorris igneus: Metig_0363Help
Entry
Metig_0363        CDS       T01510                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mig  Methanotorris igneus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metig_0363
   01230 Biosynthesis of amino acids
    Metig_0363
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metig_0363
   00051 Fructose and mannose metabolism
    Metig_0363
   00562 Inositol phosphate metabolism
    Metig_0363
Enzymes [BR:mig01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Metig_0363
Exosome [BR:mig04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Metig_0363
  Exosomal proteins of bladder cancer cells
   Metig_0363
  Exosomal proteins of melanoma cells
   Metig_0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
374564..375229
Genome map
AA seq 221 aa AA seqDB search
MKPVIIINYKTYKESIGKRGLEIAKIAEKVSEESGITIGVAPQFVDLRIVAENVNIPVYA
QHIDAITPGSHTGHVLAEAIKDCGVKGTLLNHSERNMLLSDIDKAIEIAKSLELETIVCT
NNINVSKAVAALNPTYIAIEPPELIGTGIPVSKANPEIVEGTVKEVRKINKDVKILCGAG
ISTGSDVKAALELGTDGVLLASGVVKAKDVEKAIRDLISEI
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagttataatcatcaactacaaaacatacaaagaaagtatagggaagagggga
ttagagatagcaaaaattgctgagaaggtttcagaggagagcggcataacaattggtgtt
gctcctcaatttgtagatttaagaatagttgctgagaatgtaaatattcctgtatacgct
cagcacattgatgccataacacctggaagccatacaggacatgtgttggcagaggctatt
aaggattgtggtgttaaagggactttgttaaaccattcagaaagaaatatgctcttatca
gacattgataaagccatagaaattgcaaagagtttggaacttgagaccattgtttgcacc
aacaacataaatgtatcaaaagccgttgcagcattaaatccaacttacattgccatagaa
ccaccagaattaattggaactggaattcctgtttccaaagcaaacccagagattgttgaa
ggaacagttaaagaagttagaaaaataaacaaggatgtcaaaattctttgtggagctgga
atatcaactggaagtgatgtaaaagcagcattggaacttggaacagatggagttttactt
gcatctggtgtagtcaaggcgaaagatgttgaaaaagcaataagagatttgataagtgag
atttaa

DBGET integrated database retrieval system