KEGG   Methanotorris igneus: Metig_0395Help
Entry
Metig_0395        CDS       T01510                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mig  Methanotorris igneus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mig01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mig01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mig00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mig00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mig00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:mig00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
410859..412010
Genome map
AA seq 383 aa AA seqDB search
MDNNKITVSVIKADVGGLCGHTLAPEDLLEACEGVLEEAVDELIIDYYVTRCGDDVDLIM
THKMGVDNEKIHKLAWNAFEEATKIAKELKLYGAGQDLLAECFSGNVRGLGPGCAEMEFV
ERPSEPIVVFCCDKTDPAAFNLPLYKIFADPFNTAGLVFDPSMTSGFAFEVHDVIGSKKV
ILNTPEETYSLLALIGDVERYAIKRVYRRRDNEIAAVVSTEKLNYIAGEYVGKDDPVAVV
RAQSGFPAVGEILEPFANPHFVAGWMRGSHWGPLMPVGEEDATPSRFDGPARIMALGFQL
ADGMLIGPNDLFADKGFDKAREKALEMADIIRRMGPFQPHRLPSGMMEYTTVPKVLEKLK
DRFEPLDDEPKKLEKCRDRGDVE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggataacaacaaaataactgttagtgtaattaaggcagatgtcggtggtttatgtgga
cacacattagcaccagaggatttattagaagcttgtgaaggtgtgttagaggaggcagtt
gatgaattaataattgactattatgtcacaagatgtggggatgacgtagatttaattatg
acacacaaaatgggagtagataacgaaaaaatacacaaattagcatggaacgcatttgaa
gaagcaactaagattgcaaaagaacttaaattgtatggggcaggacaagatttacttgca
gaatgtttctctggaaatgttagaggattgggtccaggatgtgcagaaatggagttcgtt
gagagaccaagcgaaccaatagtcgtattctgctgtgacaaaacagacccagcggcattt
aacttgccattatacaagatatttgctgacccatttaacacagcaggtttagtatttgac
ccatcaatgacaagtggatttgcatttgaagttcacgacgtaataggcagcaaaaaagtt
attttaaacaccccagaagagacatactcattattagcattgattggggatgttgaaaga
tatgcaattaagagagtttatagaagaagagataatgaaattgcagcagttgtcagtact
gagaaattaaactacattgcaggggagtatgttggtaaagacgacccagttgcagttgta
agggcacaaagtggattcccagcagttggggaaatattagagccatttgctaacccacac
tttgttgcaggatggatgagaggtagccactggggtccattaatgcctgttggtgaggaa
gacgcaacaccttcaagatttgatgggcctgcaagaattatggcgttaggattccaattg
gcagatggtatgttaatagggccaaacgacttgtttgcagataagggcttcgataaagca
agagaaaaagctttagaaatggcagacattataagaagaatggggccattccaaccacac
agattaccatcaggaatgatggaatatacaacagtcccaaaggtcttagaaaaattaaaa
gatagatttgagccacttgatgatgagcctaaaaaattagaaaaatgtagggatagagga
gatgtagaataa

DBGET integrated database retrieval system