KEGG   Methanotorris igneus: Metig_0395Help
Entry
Metig_0395        CDS       T01510                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mig  Methanotorris igneus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metig_0395
   01230 Biosynthesis of amino acids
    Metig_0395
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metig_0395
   00030 Pentose phosphate pathway
    Metig_0395
   00051 Fructose and mannose metabolism
    Metig_0395
  Energy metabolism
   00680 Methane metabolism
    Metig_0395
Enzymes [BR:mig01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Metig_0395
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Metig_0395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
410859..412010
Genome map
AA seq 383 aa AA seqDB search
MDNNKITVSVIKADVGGLCGHTLAPEDLLEACEGVLEEAVDELIIDYYVTRCGDDVDLIM
THKMGVDNEKIHKLAWNAFEEATKIAKELKLYGAGQDLLAECFSGNVRGLGPGCAEMEFV
ERPSEPIVVFCCDKTDPAAFNLPLYKIFADPFNTAGLVFDPSMTSGFAFEVHDVIGSKKV
ILNTPEETYSLLALIGDVERYAIKRVYRRRDNEIAAVVSTEKLNYIAGEYVGKDDPVAVV
RAQSGFPAVGEILEPFANPHFVAGWMRGSHWGPLMPVGEEDATPSRFDGPARIMALGFQL
ADGMLIGPNDLFADKGFDKAREKALEMADIIRRMGPFQPHRLPSGMMEYTTVPKVLEKLK
DRFEPLDDEPKKLEKCRDRGDVE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggataacaacaaaataactgttagtgtaattaaggcagatgtcggtggtttatgtgga
cacacattagcaccagaggatttattagaagcttgtgaaggtgtgttagaggaggcagtt
gatgaattaataattgactattatgtcacaagatgtggggatgacgtagatttaattatg
acacacaaaatgggagtagataacgaaaaaatacacaaattagcatggaacgcatttgaa
gaagcaactaagattgcaaaagaacttaaattgtatggggcaggacaagatttacttgca
gaatgtttctctggaaatgttagaggattgggtccaggatgtgcagaaatggagttcgtt
gagagaccaagcgaaccaatagtcgtattctgctgtgacaaaacagacccagcggcattt
aacttgccattatacaagatatttgctgacccatttaacacagcaggtttagtatttgac
ccatcaatgacaagtggatttgcatttgaagttcacgacgtaataggcagcaaaaaagtt
attttaaacaccccagaagagacatactcattattagcattgattggggatgttgaaaga
tatgcaattaagagagtttatagaagaagagataatgaaattgcagcagttgtcagtact
gagaaattaaactacattgcaggggagtatgttggtaaagacgacccagttgcagttgta
agggcacaaagtggattcccagcagttggggaaatattagagccatttgctaacccacac
tttgttgcaggatggatgagaggtagccactggggtccattaatgcctgttggtgaggaa
gacgcaacaccttcaagatttgatgggcctgcaagaattatggcgttaggattccaattg
gcagatggtatgttaatagggccaaacgacttgtttgcagataagggcttcgataaagca
agagaaaaagctttagaaatggcagacattataagaagaatggggccattccaaccacac
agattaccatcaggaatgatggaatatacaacagtcccaaaggtcttagaaaaattaaaa
gatagatttgagccacttgatgatgagcctaaaaaattagaaaaatgtagggatagagga
gatgtagaataa

DBGET integrated database retrieval system