KEGG   Methanotorris igneus: Metig_0400Help
Entry
Metig_0400        CDS       T01510                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mig  Methanotorris igneus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Metig_0400
   00052 Galactose metabolism
    Metig_0400
   00500 Starch and sucrose metabolism
    Metig_0400
   00520 Amino sugar and nucleotide sugar metabolism
    Metig_0400
Enzymes [BR:mig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Metig_0400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
417199..418050
Genome map
AA seq 283 aa AA seqDB search
MIKKAIVPVAGFGTRLLPITKAQPKEMLPVVGKPIIQYVVEHLIDAGIKNILMVTGKGKQ
AIVNHFDKNFELEERLRRDGKISLLNTVREIDNLANIFYVRQKEQKGLGDAILCGEGFVG
DEYFIAMVGDTIYSENVVKDLIKVHEKYGCSVIALERVPMEEVYKYGVIKGEEIEDGIYK
ITDMVEKPPVDKAPSNLIITGAYLLSPKIFECLKRTPPGRGGEIQITDAMKLLLKEEEIL
GVEIKCRRYDIGDLLGWLKANVELGIENVDGFKEYLKDFTGKL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaagcgatagttcctgtagctggttttggaacgaggttattaccaataaca
aaggctcagccaaaagaaatgcttcctgttgttgggaagccaataattcagtatgttgtt
gagcatttaattgatgcagggattaaaaatatactaatggtaactggtaaaggaaagcag
gcgattgtaaatcactttgataaaaatttcgaacttgaggaaagattaagaagagatggg
aaaataagtttgttaaatactgttagggagatagataatttagcaaatatattctatgtg
agacagaaagagcagaaagggttaggagatgccatcttatgcggagaggggtttgttgga
gacgaatacttcatagcaatggtcggagatactatatactctgaaaatgtagttaaagac
ttaattaaagttcatgaaaaatatggatgttcagttattgcattggagagagtcccaatg
gaagaggtctataaatatggagttataaaaggagaagagattgaagatggcatatacaag
ataacagacatggtagaaaagcctccagtagataaggcaccatcaaacttaataattact
ggggcttatttattatctccaaagatatttgagtgtctaaaaagaactcctccaggaaga
ggaggggaaatacagataactgatgctatgaaattactgctgaaagaggaagaaatatta
ggcgttgaaattaaatgcaggagatatgatattggagatttgttgggatggttaaaggca
aatgtagagttgggtattgaaaatgtagatgggtttaaagaatatctaaaagatttcaca
ggaaagttgtag

DBGET integrated database retrieval system