KEGG   Methanotorris igneus: Metig_0468Help
Entry
Metig_0468        CDS       T01510                                 

Definition
4Fe-4S ferredoxin
Orthology
K00204  
4Fe-4S ferredoxin
Organism
mig  Methanotorris igneus
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metig_0468
  Energy metabolism
   00680 Methane metabolism
    Metig_0468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
477529..477966
Genome map
AA seq 145 aa AA seqDB search
MPEHILSGIKALVAMKMRKEGKLQKEIAEYLNMDRSIVSHYLHGRYPSDRVMKVSEVIVE
LPVEYGARIIHSLSNDKYIAKKLIKVIYNAKIKIEKDKCLACGACLGCEAISIEGIEVKI
NENRCVLCGECISKCPMNALKFVEE
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgccagagcatatactgtcagggataaaagcacttgtagcaatgaagatgagaaaggag
ggaaaattacaaaaagagattgcagagtacttaaatatggacaggtcaatagtttcccac
taccttcacggtagatatccttcagatagggttatgaaagtctcagaagtgatagtagaa
cttccagtagagtatggagcaaggataatccactctctaagtaacgacaagtatattgca
aagaaactcataaaagttatctacaatgccaagataaaaattgaaaaggataaatgcctt
gcctgtggagcatgcctcggctgtgaggcaatatcaatagaaggtattgaagtaaaaatt
aatgagaatcgttgtgttttatgtggagaatgcataagcaaatgtcctatgaatgcttta
aaatttgtggaggaatga

DBGET integrated database retrieval system