KEGG   Methanotorris igneus: Metig_0599Help
Entry
Metig_0599        CDS       T01510                                 

Definition
(GenBank) ATPase associated with various cellular activities AAA_5
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mig  Methanotorris igneus
Pathway
mig00860  Porphyrin and chlorophyll metabolism
mig01100  Metabolic pathways
mig01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metig_0599
Enzymes [BR:mig01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Metig_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_16 Mg_chelatase_C AAA_22 DUF853 AAA
Motif
Other DBs
NCBI-ProteinID: AEF96153
UniProt: F6BCE2
Position
complement(607845..608924)
Genome map
AA seq 359 aa AA seqDB search
MMNYPFTAIVGQEKMKKALILNAINPKIGGVLIRGEKGTAKSTTVRALADLLPEIEVVEG
CPFNCDPNGDLCDICREKKERGELKTIKKKMKVINLPIGATEDRVIGTLDIEKAIKEGIK
ALDPGILAEANRNILYIDEVNLLDDHIVDILLDAAAMGWNIIEREGIKIKHPSRFILVGT
MNPEEGELRPQILDRFGLMVDVEGLNDIKQRVEVIKRVEEFNENPEEFYKKYEEEQLKLR
EKIEKARELLKNVKISDDLLELISKICIELGIPTNRADITVARTAKTIAAFNGRDYVTVD
DVKEACELALPHRMRRKPFEPPQLNKEKIEQIFNEFEEKNNEKNEDEKGNKENDKVKKN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgatgaactatccatttaccgcaattgttggacaagagaagatgaagaaagcattaatt
ctaaacgctataaacccaaaaattggtggggttttaataagaggggagaagggaacagca
aaatctacaacagtaagggctttggctgatttgttgccggagattgaagttgttgaagga
tgtccgttcaactgtgatcctaatggggatttgtgtgatatatgtagagaaaagaaggaa
aggggagaactaaaaacaattaagaaaaagatgaaagttattaacctcccaattggtgca
acggaggatagggttattggaacccttgatattgaaaaggcaattaaggagggaattaaa
gcccttgaccctggaattttggctgaggcaaataggaatattttgtatattgatgaggtt
aaccttttagatgaccatattgttgatatccttttagatgctgctgcaatgggatggaat
attattgagagagaagggataaaaataaaacatccctcacgatttatcttagttggaacg
atgaaccctgaagaaggggagttgagacctcaaatccttgataggttcgggttgatggtg
gatgttgaggggttgaatgacataaagcagagggttgaggtaataaaaagggttgaagag
ttcaatgagaatccagaggagttttataaaaaatatgaagaagagcaattaaagttgagg
gaaaagatagagaaagcaagagaattattaaagaatgtaaaaataagtgatgatttattg
gaattaatttcaaaaatctgcattgagttgggtattccaacaaatagggcagatataacg
gttgcgagaacggcaaaaaccattgctgcatttaatggaagggattatgtaactgttgat
gatgtaaaagaggcatgtgaacttgccctcccacatagaatgaggaggaagccatttgaa
ccaccacaattaaacaaggagaagattgaacaaatatttaatgagtttgaggagaagaat
aacgaaaaaaatgaagatgaaaaaggtaataaagaaaatgataaagtaaaaaaaaactaa

DBGET integrated database retrieval system