KEGG   Methanotorris igneus: Metig_0599Help
Entry
Metig_0599        CDS       T01510                                 

Definition
ATPase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mig  Methanotorris igneus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metig_0599
Enzymes [BR:mig01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Metig_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(607845..608924)
Genome map
AA seq 359 aa AA seqDB search
MMNYPFTAIVGQEKMKKALILNAINPKIGGVLIRGEKGTAKSTTVRALADLLPEIEVVEG
CPFNCDPNGDLCDICREKKERGELKTIKKKMKVINLPIGATEDRVIGTLDIEKAIKEGIK
ALDPGILAEANRNILYIDEVNLLDDHIVDILLDAAAMGWNIIEREGIKIKHPSRFILVGT
MNPEEGELRPQILDRFGLMVDVEGLNDIKQRVEVIKRVEEFNENPEEFYKKYEEEQLKLR
EKIEKARELLKNVKISDDLLELISKICIELGIPTNRADITVARTAKTIAAFNGRDYVTVD
DVKEACELALPHRMRRKPFEPPQLNKEKIEQIFNEFEEKNNEKNEDEKGNKENDKVKKN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgatgaactatccatttaccgcaattgttggacaagagaagatgaagaaagcattaatt
ctaaacgctataaacccaaaaattggtggggttttaataagaggggagaagggaacagca
aaatctacaacagtaagggctttggctgatttgttgccggagattgaagttgttgaagga
tgtccgttcaactgtgatcctaatggggatttgtgtgatatatgtagagaaaagaaggaa
aggggagaactaaaaacaattaagaaaaagatgaaagttattaacctcccaattggtgca
acggaggatagggttattggaacccttgatattgaaaaggcaattaaggagggaattaaa
gcccttgaccctggaattttggctgaggcaaataggaatattttgtatattgatgaggtt
aaccttttagatgaccatattgttgatatccttttagatgctgctgcaatgggatggaat
attattgagagagaagggataaaaataaaacatccctcacgatttatcttagttggaacg
atgaaccctgaagaaggggagttgagacctcaaatccttgataggttcgggttgatggtg
gatgttgaggggttgaatgacataaagcagagggttgaggtaataaaaagggttgaagag
ttcaatgagaatccagaggagttttataaaaaatatgaagaagagcaattaaagttgagg
gaaaagatagagaaagcaagagaattattaaagaatgtaaaaataagtgatgatttattg
gaattaatttcaaaaatctgcattgagttgggtattccaacaaatagggcagatataacg
gttgcgagaacggcaaaaaccattgctgcatttaatggaagggattatgtaactgttgat
gatgtaaaagaggcatgtgaacttgccctcccacatagaatgaggaggaagccatttgaa
ccaccacaattaaacaaggagaagattgaacaaatatttaatgagtttgaggagaagaat
aacgaaaaaaatgaagatgaaaaaggtaataaagaaaatgataaagtaaaaaaaaactaa

DBGET integrated database retrieval system