KEGG   Methanotorris igneus: Metig_0603Help
Entry
Metig_0603        CDS       T01510                                 

Definition
RimK family alpha-L-glutamate ligase
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mig  Methanotorris igneus
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Metig_0603
Enzymes [BR:mig01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     Metig_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(614488..615363)
Genome map
AA seq 291 aa AA seqDB search
MKMGIISEEKDWVVNELKKSMEKNGIKPEIIKPSNIISGIGMGFKLKCNDKNLLDLDCAF
VRNIGNEVEMFHRFDFLKYLEHYIPLINPLDGIENAGNKYRCSFLMDLKNIPQPRTVVTE
NIDEALKWVNAFEDCVVKPLFGHQGKGIMRINGGSLISKLNKLTEFKKKYGAFYIQEFVK
NPNNVYRDIRAFVVGDEVVSAMYRVSDNWITNIHQNAKPEECEVNDEIEELAIKAKDALG
LVYAGVDLIESRDGLKVLEVNATPSWEGLSKISKVNIADRIIEEVVNLLKR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggggataatatcagaggaaaaggattgggtcgtaaacgaattaaaaaaatct
atggaaaaaaatggtattaaacctgagataataaagccatctaacataatatctggtata
ggcatgggttttaagttgaagtgtaatgataaaaatctattggatttggattgtgcattt
gttaggaatattgggaacgaagtggaaatgttccataggtttgattttttaaagtatttg
gagcattatattccattaataaacccattagacggaatagaaaatgctggaaataaatat
aggtgttcttttttgatggatttaaaaaacatcccccagccaagaacggttgtaactgag
aatatagatgaggcgttaaagtgggttaatgcttttgaggactgtgttgtaaagccactt
tttggacatcaggggaagggaattatgagaataaatggtggctctttaatatccaaacta
aataaactgacagaattcaagaaaaaatatggggctttttatattcaagaatttgtaaaa
aatccgaacaatgtttatagagatattagagcatttgttgttggggatgaagttgtatcg
gcaatgtatagggtttcagataattggataactaatatccaccaaaatgcaaaaccagag
gaatgtgaagttaatgatgaaattgaagaacttgccataaaggcaaaggatgcgttggga
ttggtttatgctggggtagatttgattgagagtagggatggtttgaaggttttagaagtt
aatgcaactccatcttgggaggggttatcaaaaatctcaaaagtcaatattgccgataga
ataattgaagaggttgtaaatttattaaaaagataa

DBGET integrated database retrieval system