KEGG   Methanotorris igneus: Metig_0832Help
Entry
Metig_0832        CDS       T01510                                 

Definition
(RefSeq) thymidine phosphorylase
  KO
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
mig  Methanotorris igneus
Brite
Enzymes [BR:mig01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     Metig_0832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(847125..848642)
Genome map
AA seq 505 aa AA seqDB search
MLFLKAKLFDLDIGINAVIMNEEDLKGTPYYPQDRVLVETPAGSFVGVLHSTKTLVNKGE
IGIFREITKEIPVKDGDEVIIRHAETPLSVAYIRKKMDGQTLKPEEIHTIIDEMVAGKLS
NIENTAFVTALYINGMDMKEIEEMTKRMAETGDMIDWEESLVVDVHSIGGVPGNKTALLV
VPIVAAAGLTIPKTSSRAITSAAGTADVVEVLTRVDLSLDEIKQVVTTTNGCMVWGGAID
LAPADDITINVERPLSIDPEPLLLSSVMSKKIAAGIKYLVIDIPTGEGAKVKTVDEAASL
ARKFIELGERVNVHVECAITYGGQPIGRAIGPALEAKEALMALENYKEAPSSLIEKALSL
AGMLLEMGGVAPHGRGKSVAEEILASGKALEKMHEIITAQGGEPKSSDEIEVGEYKAEII
APMDGYVTQISNKLITKVAKEAGAPRDKKAGVYLNVKIGNKVEKGDVLYTIYSSSEERLN
AAIKLARRTYPVKVEGMLLKRISRF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgctgttcttaaaagcgaaattgtttgatttggacattgggataaatgcagttattatg
aatgaggaagatttgaaagggactccttactatccacaagatagagtgttggttgagacc
ccagcaggttcttttgttggtgtgttgcattcaacaaaaacattagttaataagggggaa
ataggaatatttagagaaattacaaaagaaattcctgttaaagatggggatgaggttata
ataaggcatgctgaaactccactttcagtggcgtatataagaaagaagatggatggtcaa
acattaaaaccagaagagatacatacaataattgatgagatggtagcagggaagttatca
aacattgaaaatacagcatttgttactgccttgtatatcaacggtatggatatgaaggaa
attgaagaaatgacaaaaagaatggcagaaactggagacatgattgattgggaagagagt
ttagtagttgatgtgcacagtattggaggggttccaggaaataaaactgcccttttagtt
gttcctatagtagcagcggcagggctcacgataccaaaaacatcctcaagagcaattaca
tcagcagctggaacagcagacgttgttgaagttttgacaagggttgatttatcattggat
gagataaagcaggtagtaacaaccacaaatggttgtatggtttggggaggggctattgac
ttggctccagcggatgatataacaataaatgttgagaggcctttgtcaatagatcctgag
ccattgcttttgtcaagtgtaatgtccaagaaaattgctgctggtattaagtatttggtt
atagatatccctacaggtgagggggcaaaggtaaaaaccgtagatgaggcagcaagtttg
gcaaggaaatttatagagttgggagagagagtaaatgtgcatgttgaatgtgcaataact
tatggagggcagccgataggtagggcaataggtcctgcattagaggcaaaagaggcgttg
atggcattggagaactataaagaggcaccttcaagtttgattgaaaaggcgttatcattg
gcagggatgcttttagagatgggtggtgtggcaccacatggaagaggaaaatctgttgca
gaggaaattttagcatctggaaaggcactggagaagatgcatgaaataataactgctcaa
ggtggagaaccaaagagttctgatgaaattgaagttggagaatataaggcagagataata
gcaccgatggatggttatgtaacacaaatctcaaacaaacttataacaaaggtggcaaaa
gaggccggagctccaagggataaaaaggcaggagtatatttaaatgttaaaattggaaat
aaggtagaaaagggagatgtcctctatacgatatattcaagttcagaagaaaggttaaat
gcagcaattaaattggcaaggagaacatatcctgtcaaagttgaaggaatgctgttgaag
agaatcagcagattctaa

DBGET integrated database retrieval system