KEGG   Methanotorris igneus: Metig_0919Help
Entry
Metig_0919        CDS       T01510                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mig  Methanotorris igneus
Pathway
mig00300  Lysine biosynthesis
mig01100  Metabolic pathways
mig01120  Microbial metabolism in diverse environments
mig01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Metig_0919
Enzymes [BR:mig01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Metig_0919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AEF96462
UniProt: F6BDA1
Position
complement(919649..920923)
Genome map
AA seq 424 aa AA seqDB search
MTIRIKGVYMKDIIEETIKISSDLIKINSVNPTFGGKGEKEKAEYVLNKLGEYIKKYNIK
NCTIKTYNVVDKYGIERPNIVAKFDFEKEKTLHIISHLDTVPEGDLSLWETNPYEPVIKD
GMIYGRGSEDNHKAIVSSFLLLKMIFESNISPKYNLCLIFVSDEEDGSEYGLKYLLDNYE
KEIFKKDDLIIVPDFGTPEGNYIEIAEKSILWIKFKIKGKQCHGSMPDDGINADILMFNF
ANGLYRRLYEKYNRKDGIFSPPQSTFEPTVIVNNVENTNTIPGYVEVCFDCRILPDYDVD
EVLKFIEEYIKEFKKNIDKYLILYDKKNEDEIEITYEILKVEKSQRTKEDSTIVLELKDV
IKKVLNKEPKLCGMGGGTVAAFLREKGYDTVVWGIGKETAHQPNEHIKIEDLIKMAKIFY
EILK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgactataagaattaaaggtgtctatatgaaagacattatagaggaaaccataaaaata
tcatccgatttaatcaagataaattcagtaaatccaacatttggaggaaaaggagagaag
gaaaaggcagaatatgtattaaacaaattaggtgagtatattaaaaaatacaacataaaa
aactgcactataaaaacatacaacgttgtggataaatatggcatagaaagacctaatata
gttgcaaaatttgattttgaaaaagaaaagaccttacatatcatttctcaccttgatacg
gttccagagggcgatttaagtttatgggaaactaatccttatgagccagttataaaggat
ggtatgatatatgggagggggagtgaagataaccataaagcaattgtttcttcatttttg
ctgttgaaaatgatttttgaaagcaatatttccccaaaatacaatttatgtttaatattt
gtgtctgatgaggaagatggcagtgaatatgggttaaaatatctattagataactatgaa
aaagagatattcaaaaaggatgatttaataattgtcccagattttggtacgccagaaggg
aactacattgagatagcagagaaaagcatattgtggattaaatttaaaataaaaggaaag
cagtgccatggaagtatgccagatgatggaattaatgccgacatcttaatgtttaacttt
gcaaatgggttgtataggagattgtatgagaaatataatagaaaagatggtatcttttcc
ccaccacaatcaacttttgagccaacagttattgtaaataatgtagaaaacaccaacaca
attccgggatatgttgaagtttgctttgattgtaggattttgccagattatgatgtagat
gaggttttgaaatttattgaggagtatattaaggagtttaagaaaaatattgataaatat
ctcatcctttatgataaaaagaatgaagatgagattgagattacctacgaaatactaaag
gtggaaaaatcccaaagaacaaaggaagattccacaatagttttagagttaaaggatgta
ataaagaaagttttaaataaagagccaaaactttgtggaatgggtggaggaacagtggca
gcgtttttgagagagaaggggtatgatacagtagtttggggtattggtaaggaaacagcc
catcaaccaaatgagcatataaaaatagaggatttaataaaaatggcgaaaatattctat
gaaattttaaaataa

DBGET integrated database retrieval system