KEGG   Methanotorris igneus: Metig_0919Help
Entry
Metig_0919        CDS       T01510                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mig  Methanotorris igneus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metig_0919
  Amino acid metabolism
   00300 Lysine biosynthesis
    Metig_0919
Enzymes [BR:mig01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Metig_0919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(919649..920923)
Genome map
AA seq 424 aa AA seqDB search
MTIRIKGVYMKDIIEETIKISSDLIKINSVNPTFGGKGEKEKAEYVLNKLGEYIKKYNIK
NCTIKTYNVVDKYGIERPNIVAKFDFEKEKTLHIISHLDTVPEGDLSLWETNPYEPVIKD
GMIYGRGSEDNHKAIVSSFLLLKMIFESNISPKYNLCLIFVSDEEDGSEYGLKYLLDNYE
KEIFKKDDLIIVPDFGTPEGNYIEIAEKSILWIKFKIKGKQCHGSMPDDGINADILMFNF
ANGLYRRLYEKYNRKDGIFSPPQSTFEPTVIVNNVENTNTIPGYVEVCFDCRILPDYDVD
EVLKFIEEYIKEFKKNIDKYLILYDKKNEDEIEITYEILKVEKSQRTKEDSTIVLELKDV
IKKVLNKEPKLCGMGGGTVAAFLREKGYDTVVWGIGKETAHQPNEHIKIEDLIKMAKIFY
EILK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgactataagaattaaaggtgtctatatgaaagacattatagaggaaaccataaaaata
tcatccgatttaatcaagataaattcagtaaatccaacatttggaggaaaaggagagaag
gaaaaggcagaatatgtattaaacaaattaggtgagtatattaaaaaatacaacataaaa
aactgcactataaaaacatacaacgttgtggataaatatggcatagaaagacctaatata
gttgcaaaatttgattttgaaaaagaaaagaccttacatatcatttctcaccttgatacg
gttccagagggcgatttaagtttatgggaaactaatccttatgagccagttataaaggat
ggtatgatatatgggagggggagtgaagataaccataaagcaattgtttcttcatttttg
ctgttgaaaatgatttttgaaagcaatatttccccaaaatacaatttatgtttaatattt
gtgtctgatgaggaagatggcagtgaatatgggttaaaatatctattagataactatgaa
aaagagatattcaaaaaggatgatttaataattgtcccagattttggtacgccagaaggg
aactacattgagatagcagagaaaagcatattgtggattaaatttaaaataaaaggaaag
cagtgccatggaagtatgccagatgatggaattaatgccgacatcttaatgtttaacttt
gcaaatgggttgtataggagattgtatgagaaatataatagaaaagatggtatcttttcc
ccaccacaatcaacttttgagccaacagttattgtaaataatgtagaaaacaccaacaca
attccgggatatgttgaagtttgctttgattgtaggattttgccagattatgatgtagat
gaggttttgaaatttattgaggagtatattaaggagtttaagaaaaatattgataaatat
ctcatcctttatgataaaaagaatgaagatgagattgagattacctacgaaatactaaag
gtggaaaaatcccaaagaacaaaggaagattccacaatagttttagagttaaaggatgta
ataaagaaagttttaaataaagagccaaaactttgtggaatgggtggaggaacagtggca
gcgtttttgagagagaaggggtatgatacagtagtttggggtattggtaaggaaacagcc
catcaaccaaatgagcatataaaaatagaggatttaataaaaatggcgaaaatattctat
gaaattttaaaataa

DBGET integrated database retrieval system