KEGG   Methanotorris igneus: Metig_1019Help
Entry
Metig_1019        CDS       T01510                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mig  Methanotorris igneus
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mig00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metig_1019
   01230 Biosynthesis of amino acids
    Metig_1019
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metig_1019
Enzymes [BR:mig01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Metig_1019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1017562..1018584)
Genome map
AA seq 340 aa AA seqDB search
MAVKVLINGYGSIGKRVADAVAKQDDMEVIGVTKTKPDFEARLAVEKGYKLFAAIPERKE
LFEEKGVEIEGTIFDVIEDADIVVDCAPGGIGKDNLENIYKKYKVKAILQGGEKAKYVED
NFNALWSYDRCYGKDYVRVVSCNTTGLCRTLYAIDSVTDIVKARVVLIRRGADPNDAKRG
PINAIVPNPPTVPSHHGPDVVSVVPKFEGKILTSAVVVPTTLMHMHTLMVETTGTTRDAI
LDAIEKTPRIITVKASEGFDSTATIIEYARDLGRMRYDLNEIAIWEESVNVVDNEVFLMQ
AVHQESDVVPENIDCIRAMLQMEEDNMKSIEKTNKALGIK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcagttaaagtattaataaacggatatggttcaataggtaagagagttgctgatgca
gttgcaaagcaagatgatatggaggtaattggagttacaaaaacaaaaccagattttgaa
gcaagattggctgttgagaagggttataaattattcgcagcaattccagagagaaaggaa
ctatttgaagaaaaaggggttgaaattgaggggactatttttgatgtaattgaagatgca
gacatagttgtcgattgtgctcctggtggaattgggaaggacaacttagagaatatctac
aaaaaatacaaagtaaaggctattttgcaagggggagaaaaggcaaagtatgttgaggac
aacttcaacgcattgtggagttatgatagatgctatggaaaggactatgttagagttgta
tcatgtaacacaacagggttgtgtaggacattgtatgcaattgattcagttacagatatt
gttaaagcaagagttgttttaattaggagaggagcagaccctaacgatgcaaaaagaggt
ccaatcaatgcaatcgttccaaacccaccaacagttccatcccaccacgggcctgatgta
gtttcagtagttcctaagtttgaagggaagattttaacttctgctgttgtagttccaaca
acattgatgcacatgcacacattgatggtagagacaacaggaactacaagagatgctatc
ttagatgcaattgaaaaaacaccaagaataataacagttaaggcatcagagggctttgat
tcaacagcaacaattattgaatatgcaagggacttaggaagaatgagatatgacttaaat
gagattgcaatttgggaagaaagcgttaatgtcgttgacaatgaagtattcttaatgcaa
gcagtgcaccaagaaagtgacgttgtaccagaaaacattgactgtataagagcaatgctc
caaatggaagaagacaacatgaaatctattgaaaaaacaaacaaagcattgggaattaaa
taa

DBGET integrated database retrieval system