KEGG   Methanotorris igneus: Metig_1046Help
Entry
Metig_1046        CDS       T01510                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mig  Methanotorris igneus
Brite
Enzymes [BR:mig01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Metig_1046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1041866..1042510
Genome map
AA seq 214 aa AA seqDB search
MIEKMKPIVERLMYEGYIKNKKVAEALLKVPRHEFVPEDLKEYAYIDSPLEIGFGQTISA
IHMVAMMCDILDLKEGQKVLEVGTGCGYHAAVTAELVGKDGLVVTVERFPELAKRAEKTL
RRLGYDNVIVICGDGTLGYEPLAPYDRIYVTAAGPKVPRPLIEQLKDGGKLLIPVGRYVQ
HLILIEKKDGKIIEKDFGEVSFVPLVGEEGWKDY
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaaaaatgaaacctattgtagaaagacttatgtatgaaggatatatcaaaaat
aaaaaagttgctgaagctttattaaaagttccaagacatgaatttgttccagaagatttg
aaggaatatgcctatatcgatagtcctcttgaaattggctttgggcagaccatttcagca
atccacatggttgcgatgatgtgtgatattcttgatttgaaggaggggcagaaagttctt
gaggttggaactggatgcggatatcatgcagcagttacggcagaattggttggaaaagat
ggattggttgttacagttgagagatttccagagttagctaaaagagcagagaaaacatta
agaagattaggctatgataatgtaattgtgatatgtggggatggaacattgggatatgag
ccccttgctccttatgatagaatttatgtaactgctgctgggcctaaggtgccaaggcct
ttaatagagcaacttaaagatggggggaaattactaataccagttgggagatatgtgcaa
cacctcattctaattgagaaaaaagatgggaaaattattgaaaaggattttggagaagtt
tcatttgtaccacttgttggagaggaagggtggaaagattattaa

DBGET integrated database retrieval system